KEGG   Pseudomonas stutzeri CCUG 29243: A458_16695Help
Entry
A458_16695        CDS       T02168                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00970  Aminoacyl-tRNA biosynthesis
psc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A458_16695 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psc03029]
    A458_16695 (gatB)
Enzymes [BR:psc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A458_16695 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A458_16695 (gatB)
Mitochondrial biogenesis [BR:psc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A458_16695 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFM34564
UniProt: I4CWV7
LinkDB All DBs
Position
3598360..3599805
Genome map
AA seq 481 aa AA seqDB search
MQWETVIGLEIHAQLATQSKIFSGSATTFGAEPNTQASLVDLGMPGTLPVLNAEAVRMAC
KFGLAIDAEIAPKNVFARKNYFYPDLPKGYQTSQMDHPIVGKGYLDITLEDGSTRRIGIT
RAHLEEDAGKSLHEDFHGMSGIDLNRAGTPLLEIVSEPDIRSAKEAVAYVKAIHALVRYL
GICDGNMAEGSLRCDCNVSVRPKGQAEFGTRAEIKNVNSFRFIEKAINHEVQRQIELIED
GGKVVQETRLYDPNKDETRSMRSKEEANDYRYFPCPDLLPVVIEQSFLDEVRASLPELPV
QKRERFEREFGLSAYDADVLAASRELADYFEQVNATCSDAKLAANWVMGELSSLLNKEAL
EIAQSPVSAEQLGGMILRIKDDTISGKIAKMVFESMAAGEGSADEIIEKKGLKQVTDSGA
IESMLDEVLAANAEQVEQYRSSDEAKRGKMFGFFVGQAMKASKGKANPGQVNQLLKKKLE
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgggaaaccgtgatcgggctggagatccacgcacagctcgcgacccagtcgaag
atcttttccggcagcgccaccaccttcggcgccgagcccaacacccaggccagcctggtc
gacctcggcatgcccggcaccctgccggtgctcaatgctgaagccgtgcgcatggcctgc
aagttcggcctggcgatcgatgccgagatcgcgccgaagaacgtcttcgcgcgcaagaac
tacttctaccctgacctgcccaagggctaccagaccagccagatggaccatcccatcgtc
ggcaagggctatctggacatcaccctggaagatggcagcacccgccgcatcggcatcacc
cgcgcgcacctggaagaggacgccggcaagagcctgcacgaagacttccacggcatgagc
gggatcgacctgaaccgcgctggcacaccgctgctggagatcgtctccgagccggacatc
cgttcggccaaggaagcggtcgcctacgtcaaggcgatccacgccctggtgcgctacctc
ggcatctgcgacggcaacatggccgaaggttcgctgcgctgcgactgcaacgtctcggtg
cggccgaaaggccaggccgagttcggcacccgcgccgagatcaagaacgtcaactccttc
cgcttcatcgagaaggcgatcaaccacgaggtgcagcggcagatcgagctgatcgaggac
ggcggcaaggtggtgcaggaaacccgcctgtacgacccgaacaaggacgagacgcgctcg
atgcgcagcaaggaagaagccaacgactaccgctacttcccctgccctgacctgctgccc
gtagtgatcgagcagagcttcctcgacgaagtgcgcgccagcctgcccgagttgccggta
cagaagcgcgaacgcttcgagcgcgagttcggcctgtcggcctatgacgccgacgtgctg
gcggccagccgtgaactggccgactacttcgaacaggtcaatgccacctgcagcgatgcc
aagctggccgccaactgggtgatgggcgagctgtccagcttgctcaacaaggaagccctg
gagatcgcgcagtcaccggttagcgccgagcagctgggcggcatgatccttcgcatcaag
gacgacaccatcagtggcaagatcgccaagatggtcttcgagtccatggccgccggcgaa
ggttcggctgacgagatcatcgagaagaagggcctcaagcaggtcactgattccggcgcc
atcgagtcgatgctggacgaagtgctggcagcgaatgccgagcaggtcgaacagtaccgc
tccagcgacgaagccaagcgcggcaagatgttcggcttcttcgtcggccaggcgatgaag
gcttccaagggcaaggccaaccctggccaggtgaaccaactgctgaagaaaaaactcgaa
ggctaa

DBGET integrated database retrieval system