KEGG   Pseudomonas stutzeri CCUG 29243: A458_20910
Entry
A458_20910        CDS       T02168                                 

Definition
(GenBank) serine/threonine phosphoprotein phosphatase Stp1
  KO
K11915  serine/threonine protein phosphatase Stp1 [EC:3.1.3.16]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc02025  Biofilm formation - Pseudomonas aeruginosa
psc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A458_20910
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    A458_20910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psc02044]
    A458_20910
Enzymes [BR:psc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     A458_20910
Secretion system [BR:psc02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   A458_20910
SSDB
Motif
Pfam: PP2C_2 PP2C SpoIIE
Other DBs
NCBI-ProteinID: AFM35397
UniProt: I4CZ90
LinkDB
Position
4508218..4508949
AA seq 243 aa
MSATACSWRSAARTDTGKVRARNEDAFLDLPQAGLWAVADGMGGHQNGALASRLIVEQLA
DLSSTGDLPERVLALRCCLHELNRRLSQELTITAERPDPVIGSTVVALLVEDDRAACIWA
GDSRCYLWRSGRLYQLSRDHSLLQQLLDEQQLTPEQAARHPAAHALTRAIGASEKLELDI
LEFGVFPGDTLLLCSDGLHQSMSADALGAALSLPSTHLALERLFRQALKGPARDNISAVV
IRR
NT seq 732 nt   +upstreamnt  +downstreamnt
atgagcgcgacggcgtgtagctggcgcagcgcggcgcgcaccgacactggcaaggtgcgg
gcgcgcaacgaagatgccttcctcgacctcccgcaggccggcctctgggccgtggccgac
ggcatgggcggacaccagaacggcgcgctggcgagtcgcctgatcgtcgagcagctggcc
gatctgtcctctacgggcgacctgccagagcgggtgctggcgctgcggtgctgcctgcac
gagctgaatcgccggctcagccaggaactgacgatcaccgccgaacgcccggacccggtg
atcggcagcaccgtggtcgccctgctcgtggaggatgaccgcgcggcatgcatctgggcc
ggcgacagccgctgttatctgtggcgcagtgggcggctctatcagctatcgcgggatcat
tcgctgttgcagcagctgctcgacgagcaacaactgacccccgaacaagcggccaggcat
cctgcggcccatgcgctgacccgcgccatcggggccagtgaaaagttggagctggacatc
ctcgagttcggggtgtttcccggcgacacgctgctgctatgcagcgatgggcttcatcaa
agcatgtccgccgacgccctcggtgcggcactcagcctcccatccacacacctggcactg
gagcggctgtttcgccaggcattgaaggggccggcacgggacaacatcagcgccgtggtg
atccgccgatga

DBGET integrated database retrieval system