KEGG   Phialocephala scopiformis: LY89DRAFT_181885Help
Entry
LY89DRAFT_181885  CDS       T04865                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psco  Phialocephala scopiformis
Pathway
psco00250  Alanine, aspartate and glutamate metabolism
psco00410  beta-Alanine metabolism
psco00430  Taurine and hypotaurine metabolism
psco00650  Butanoate metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
Module
psco_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LY89DRAFT_181885
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LY89DRAFT_181885
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LY89DRAFT_181885
   00430 Taurine and hypotaurine metabolism
    LY89DRAFT_181885
Enzymes [BR:psco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LY89DRAFT_181885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 28815344
NCBI-ProteinID: XP_018077775
JGI: 181885
UniProt: A0A194XSY8
LinkDB All DBs
Position
Unknown
AA seq 555 aa AA seqDB search
MSLAKHVDPDEIISGLQKMQMNEGGHNHAHTKGGTSHITPYSTRYASKQEISKFIIPQEG
APADAVHQMLKDELDLDGRPNLNLASFVGTYMETHAEQLMFENISKNMSDADEYPAMMQM
HARCVSIISHLWGVQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKRTAAGKDTSKPNII
MGSNAQVALEKFARYFEVEARILPVTQKSNYRLDPELVKQNIDENTIGIFVILGSTYTGH
YEPVEEISQILDAYEAETGVDIPIHVDAASGGFVAPFTHAKAGGPKWNFELPRVKSINTS
GHKFGLVYAGVGWIIWRDETLLPKHLVFELHYLGGTEESYTLNFSRPGAQVIAQYYNLIH
LGFSGYRQIMENCMSNARLLSKSLEATGWYTCISDIHRKKGVFTFPGVSAAVFSKENETS
ADYNAGLPVVAFRFSDEFKQEFPHIKQVDVSNLMRAKQYIIPNYPLPPDEESTEILRVVV
RESMSFDLLDRLISDLCATTQGLIDNDKGDLSILGGARDNSAEKKHSSTGSQPHSKGQGH
GGKRPMTEGVHRAVC
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgcaaagcacgtcgatcctgatgagatcatcagtggcctccaaaagatgcag
atgaatgaaggaggtcataatcatgctcacacgaaaggcggaacctcacacattacaccc
tacagcactcgctatgcatccaagcaagaaatctccaaattcattatcccacaagaagga
gctccagcagatgcagttcaccaaatgctcaaagatgagctggatcttgatggcagacca
aacttgaatctcgccagtttcgtaggaacatacatggaaacccacgccgaacaactcatg
ttcgaaaacatctccaagaacatgtccgacgcagacgaataccccgccatgatgcaaatg
cacgcccgctgcgtctccatcatctcccacctgtggggcgtccaaaaaggcgagaaagca
atcggatccgccaccaccggctcctcagaagccatccacctcggcggtctcgccatgaag
cgccgctggcaagagaagagaacggcagcaggaaaagacacctcgaaacccaacataatc
atgggctccaacgcgcaagtcgccctcgagaaattcgcccgctacttcgaagtcgaagca
cgcatcctgcccgtgacccaaaaatccaactaccgcctcgaccccgagctcgtcaagcag
aacatcgacgagaacaccatcggcatcttcgtcatcctcggctccacctacacgggccac
tacgagcccgtcgaagaaatctcccagatcctggacgcctacgaggcggaaaccggcgtc
gatatccccatccacgttgacgccgcgtccggcggtttcgtggcccctttcacgcacgcg
aaggccgggggcccgaaatggaacttcgagctaccccgcgtgaaatcgatcaacacgtcc
ggccacaaattcgggctggtctacgcgggcgtcggatggatcatctggcgggacgaaacg
cttctgcccaagcacctagtcttcgaactgcattacttgggcggaacagaggaatcatat
accctcaatttctcgcggccaggagcgcaggtcattgcgcagtactacaacctgatccat
ctgggtttcagcggctaccgccaaataatggaaaactgcatgtcgaacgcgcgcctacta
tccaaatccctcgaagctacggggtggtacacctgcatttccgacatccaccgcaagaaa
ggcgtcttcacattccccggcgtctccgccgctgtcttcagcaaagagaacgagacgtcc
gctgattacaacgccgggttgcccgtcgtcgcattccgcttctcggatgaatttaagcaa
gaattcccgcacatcaagcaagtggacgtgagcaacctgatgcgagccaagcagtacatc
atcccgaactacccgctgccgccggatgaggagagcacggagatcttgagggtggtggtg
cgggagagtatgtcgtttgatttgttggatcggttgatttcggatctttgtgctacgacg
caggggcttattgataacgataaaggagacctctccatcctcggcggggcaagggataac
agcgccgagaagaaacactcgagcacgggctctcagcctcatagtaagggccaaggacac
ggtggcaagagaccgatgactgagggtgttcatcgtgctgtttgctag

DBGET integrated database retrieval system