KEGG   Phialocephala scopiformis: LY89DRAFT_26512Help
Entry
LY89DRAFT_26512   CDS       T04865                                 

Definition
(RefSeq) Phosphonopyruvate hydrolase complex with Phosphonopyruvate and Mg++
Organism
psco  Phialocephala scopiformis
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL SOR_SNZ
Motif
Other DBs
NCBI-GeneID: 28816030
NCBI-ProteinID: XP_018079020
JGI: 26512
UniProt: A0A194XWI7
LinkDB All DBs
Position
Unknown
AA seq 292 aa AA seqDB search
MSQQRTTIHALHTALKNTSKPSIAMSSHNALSAKLASQAGFNAIWASGFELSASHALPDA
SILPWTAHLDVVRSISSTVSIPVIADIDTGFGNAVNVAYTIPQFEQAGAAAVVIEDKTFP
KDSSLRSQGRQKLVSIEEFQGKIAAAKASSEMVIIARTEALIADLGEEEAMKRGEAYVEA
GADAVLIHSKKKTPDEILSFCRKWKGAVPLVIVPTAYPSISFKEVGELGKVGLIICGNHA
VRAAVSGMRGAFKSILEDGGIAGVEGSIASVEETFELQGDEEMREIERKFLR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacaacgaaccacaatacacgccctccacaccgccctcaaaaacacatccaag
cccagcatcgcaatgtcatcccacaacgccctctccgccaaactcgcatcccaagccggc
ttcaacgcaatctgggcctcaggattcgaactctccgcctctcacgcccttcccgacgcc
agtatcctcccctggaccgctcacctcgatgtcgtccgctcaatctcctccacggtctcc
atccccgtaatagccgacatcgacactggtttcggcaacgctgtcaacgtcgcctacacc
attccccaattcgagcaagccggcgcagcagctgtggttatcgaagacaagacctttcct
aaagacagtagtctacgttctcaaggccgacagaaattggtttcgatagaggaattccaa
ggaaagatcgctgcagccaaagcgtcctcagaaatggtcatcattgctcgaaccgaagcc
ttgatcgctgatctaggtgaagaagaggcgatgaagaggggagaagcttatgtcgaagcg
ggcgcggatgcggtgctgatacacagtaagaagaaaactccagatgagattctgagcttt
tgtcggaagtggaagggagcggtgccgttggttattgtgccaactgcttacccgagtatt
tctttcaaggaggtgggagagttgggaaaggtgggattgattatttgcgggaatcatgca
gtgagagctgcggtttctgggatgcggggggcgtttaagagcatcttggaggatggtggg
attgcgggtgttgagggaagcattgcgagtgtggaggagacttttgagttgcagggtgat
gaggagatgagggagattgagaggaagtttttgcgttga

DBGET integrated database retrieval system