KEGG   Phialocephala scopiformis: LY89DRAFT_502572Help
Entry
LY89DRAFT_502572  CDS       T04865                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco00010  Glycolysis / Gluconeogenesis
psco00051  Fructose and mannose metabolism
psco00052  Galactose metabolism
psco00500  Starch and sucrose metabolism
psco00520  Amino sugar and nucleotide sugar metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01200  Carbon metabolism
Module
psco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LY89DRAFT_502572
   00051 Fructose and mannose metabolism
    LY89DRAFT_502572
   00052 Galactose metabolism
    LY89DRAFT_502572
   00500 Starch and sucrose metabolism
    LY89DRAFT_502572
   00520 Amino sugar and nucleotide sugar metabolism
    LY89DRAFT_502572
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LY89DRAFT_502572
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:psco04131]
    LY89DRAFT_502572
Enzymes [BR:psco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     LY89DRAFT_502572
Membrane trafficking [BR:psco04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    LY89DRAFT_502572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 28817703
NCBI-ProteinID: XP_018073061
JGI: 502572
UniProt: A0A194XEY0
LinkDB All DBs
Position
Unknown
AA seq 427 aa AA seqDB search
MNPTWCMAFPTGYETGTYLALDMGGTNLRVCEIVLTDEKSEFDIIQSKYRMPEELKSGTS
EELWEYIADCLQQFIESHHAGQKLESLPLGFTFSYPATQDYIDHGVLQRWTKGFDIDGVE
GKNVVPMFEAAIAKRGAPIKLTALINDTTGTLIASAYTDTKMKIGCIFGTGCNAAYMENC
GSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEKMIAG
LYLGELFRLVLVDLHDNKEVHIFEGQNIDKLRKAYTLDSSFLSLVEEDPFENLSETGDLF
QNKLGITTTHPELELIRRLAELIGTRAARLSSCGVAAISKKKGYETCHVGADGSVFNKYP
HFKQRGAQALREILDWPAKKSSKEEDPIEILAAEDGSGVGAALIAALTLKRVKEGNMAGI
LHPENYK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccacatggtgcatggcgttccctactggttatgagactggaacatatcttgct
ctggatatgggtggcaccaacttgcgagtttgcgagattgtcttgactgacgagaaatcc
gaattcgacatcatccaatccaaataccgcatgcccgaggaattgaagtctggtacctct
gaggaattgtgggagtacatcgccgattgcctccaacagttcattgagtcccaccatgct
ggccaaaagctcgagagtcttcctcttggtttcactttctcttaccccgccacccaagat
tacatagaccacggtgttttgcaacgatggactaagggcttcgacattgatggtgttgag
ggcaagaatgttgttcccatgtttgaggctgctattgctaagagaggagcacccatcaag
cttacggccctgatcaatgataccactggtactttgatcgcttccgcctacactgatacc
aagatgaagattggatgtatcttcggaacaggttgcaatgcagcttacatggagaattgc
gggtcgattcccaagcttgctcatatgaacctgcctcccgacactccaatggccatcaac
tgcgaatggggtgctttcgacaacgagcacaaagtcctgccacgtactccttacgacatc
atcatcgacaaggattctccacgtcctggtcaacaagctttcgagaagatgattgctggt
ctctaccttggcgagcttttccgtttggttctcgttgacctccacgacaacaaggaagtc
cacatcttcgaaggccaaaacattgataagctccgcaaagcttatacccttgactcctcc
ttcctttccctggttgaagaggatccctttgagaacttgtccgagacaggtgatctcttc
cagaacaagcttggaatcactacaacccaccccgagttggagcttatccgccgccttgcg
gagctcatcggtacccgcgccgctcgcctatcctcttgtggtgtagctgccatctccaag
aagaagggctacgaaacctgtcacgttggagccgacggatccgtcttcaacaagtacccc
cacttcaagcaacgtggcgctcaagctctgcgtgagatcttggactggcccgctaagaag
agctccaaggaggaagaccccattgaaatcttggccgctgaggatggttccggtgttggt
gccgcattgattgccgcactcacacttaagcgtgtcaaggagggcaacatggcaggtatc
ctgcacccagagaactacaagtaa

DBGET integrated database retrieval system