KEGG   Phialocephala scopiformis: LY89DRAFT_591570Help
Entry
LY89DRAFT_591570  CDS       T04865                                 

Definition
(RefSeq) starch-binding glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
psco  Phialocephala scopiformis
Pathway
psco00500  Starch and sucrose metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LY89DRAFT_591570
Enzymes [BR:psco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LY89DRAFT_591570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20 BLM_N
Motif
Other DBs
NCBI-GeneID: 28819387
NCBI-ProteinID: XP_018067589
JGI: 591570
UniProt: A0A194WZV1
LinkDB All DBs
Position
Unknown
AA seq 650 aa AA seqDB search
MYSFASLAAVGSLAIQAVLSLPDPSRVKEREAEFVKRSVDSFIATESPIALADMLCNIGS
AGACASGANSGIVVASPDKTNPDYFYTWTRDSALTFKCIVDTFINSYSSSLQTEIENYIE
AQAYIQTVSNPSGGLSSGGLGEPKFNADESAFTGSWGRPQRDGPALRATALITYSKWLIN
NGYSSTASSLVWPIIQNDLSYVTQYWNNTGYDLWEEVDGSSFFTITAQHRALVEGSALAS
LLGKSCTYCDSQAPQVLCFLQSFWGSSQGYILANINENNGRTGKDANTLLGAIHQFDPAA
GCDATTFQPCSDRALANHKVVTDSFRSIYTINSGIAEGTAVAVGRYPEDSYQGGNPWYLN
TLAAAEQLYDALYTWNKQGYITVTSTSLAFFQDFSSSVAAGTYASSTSTYTTLYNAVKTY
ADGYVNVVATYAQSNGSLSEQFSKSNGVPLSAYDLTWSYAAFLTAAARRAGVVPYSWGEP
SASSVPAVCSSTSATGTYSTAPTSSWPSSQTPISGSVTTTSTSVTTTGTGTTTSTTSTST
TSSCATATSVAVTFDELVTTTYGETIKIAGSVASLGDWDTLDAVALSASSYTSSNPLWDV
ALSFAPGTVIQYKFINVASDGTVTWEADPNHTYTVPATCATATTVSSSWQ
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtattctttcgcatctctcgcggcagttggcagtcttgctatccaagccgttctatct
ttacctgatccaagtcgagttaaggaacgcgaagcagaatttgtgaagcgttctgttgat
tccttcattgctacggaaagtcctattgccttggcagatatgctttgcaacatcggatct
gcaggagcttgtgcttctggtgcaaattctggaatcgttgtggcgtcgcctgataagacc
aatccggattatttctatacctggacacgtgattctgccttgacattcaagtgcattgtg
gacacgttcatcaatagctattcttcgtccctgcagaccgagattgagaactacattgaa
gctcaagcttatatccagactgtgtcgaacccttctggtggtctttccagtggtgggctt
ggcgagccgaagttcaatgcagatgaatctgcattcacgggatcgtggggccgccctcaa
agagatggtcctgctcttcgtgctaccgctttgattacttactcgaaatggttgatcaac
aatgggtattcttccactgccagctctttggtttggccaatcatccagaatgacttgtca
tatgttacacagtactggaataatactggctacgatctctgggaagaagttgatggctcc
agcttcttcacgatcactgcccagcatcgtgcacttgttgagggtagtgctctagcttct
cttctcggcaaatcatgcacctattgtgattctcaagcacctcaagttctctgctttttg
caaagcttctggggttcttctcaagggtacattctcgcgaacatcaatgagaataacgga
cgtactggcaaggatgccaacacgcttcttggtgccatccatcagtttgaccccgcagct
ggctgtgatgcaaccaccttccaaccctgctccgatcgtgctctcgcgaaccacaaggtc
gttacagattccttccgatctatctataccatcaactcaggtatcgctgaaggaacagct
gtggctgtcggtcgatacccagaggatagctaccaaggaggcaatccatggtatttgaat
acccttgcagcagctgagcagttgtacgatgctctgtacacttggaacaagcaaggatac
atcactgtaacttccacttccctcgcattctttcaggacttcagctcatctgtcgcggct
ggcacttacgcatcttcaacgtcgacctacaccaccctgtacaatgcagtcaagacatat
gcagatggctacgtgaacgtcgtcgccacttatgcacagtcaaacggctccctgtccgag
caattctcaaaatccaacggtgtccccctttcagcatacgatctcacatggtcatatgca
gctttcttgacagcagcagctcgccgagcaggtgtggtgccatactcttggggagagccc
agtgcttcaagtgtgccagcagtgtgctcctcaacctcagccacgggaacctactccacc
gcaccgacaagctcgtggccatctagccaaactcccatctcaggctcagtaaccactacc
tcaacatctgtcacaaccaccggaaccggaactacaacttctaccacctccaccagcact
acttcatcctgtgcgaccgccacatccgtagctgtcacgttcgatgaactcgtgaccacg
acgtacggcgagacgatcaagatcgccggcagcgtggcatcactcggagactgggataca
ttggacgccgttgctctttccgcaagttcctacacttcctctaacccactatgggacgtc
gctctgagctttgctcctggaaccgtcatccaatataaattcatcaacgtcgccagcgat
ggaacagtcacctgggaagcggacccgaaccacacttacactgttccagcaacttgcgct
acagctaccacggtcagcagcagttggcaatag

DBGET integrated database retrieval system