KEGG   Phialocephala scopiformis: LY89DRAFT_619694Help
Entry
LY89DRAFT_619694  CDS       T04865                                 

Definition
(RefSeq) DNA ligase-like protein I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
psco  Phialocephala scopiformis
Pathway
psco03030  DNA replication
psco03410  Base excision repair
psco03420  Nucleotide excision repair
psco03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LY89DRAFT_619694
   03410 Base excision repair
    LY89DRAFT_619694
   03420 Nucleotide excision repair
    LY89DRAFT_619694
   03430 Mismatch repair
    LY89DRAFT_619694
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psco03032]
    LY89DRAFT_619694
   03400 DNA repair and recombination proteins [BR:psco03400]
    LY89DRAFT_619694
Enzymes [BR:psco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LY89DRAFT_619694
    6.5.1.6  DNA ligase (ATP or NAD+)
     LY89DRAFT_619694
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LY89DRAFT_619694
DNA replication proteins [BR:psco03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LY89DRAFT_619694
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LY89DRAFT_619694
DNA repair and recombination proteins [BR:psco03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LY89DRAFT_619694
   NER (nucleotide excision repair)
    Other NER factors
     LY89DRAFT_619694
   MMR (mismatch exicision repair)
    Other MMR factors
     LY89DRAFT_619694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 28820616
NCBI-ProteinID: XP_018069002
JGI: 619694
UniProt: A0A194X496
LinkDB All DBs
Position
Unknown
AA seq 876 aa AA seqDB search
MGTPAKKRKLNSDSKASPATSRSLDYFFGKQKQDPPKAVSNAEQAIDHNCDISDLTDEQL
ARKLQAEWDQEDDATKEMQENTKADATEIHAELADLPERSKHTPASEGADGEAQEPYEQP
NDTKATPFVFGAKGKNTLSLQSAGTAEDTICSNITFDESPLTFDPSKYIKDLQGHWAAEG
GDASYALLTRCFVLVNSTQSRIKIVDTLVNLLRVIIEGDPSSLLPTVWLSTNAISPPYIS
LELGLGGSAISKALKNVCGLDNKSLKALYDKVGDAGDVAFEAKKKQSFTLRKPKPLSIKG
VYQSLVKIANTQGTGSGEIKQRVVDRLLQDARGAEESRYIVRTLCQHLRIGAVKTTMLIA
LSRAFLLSRPPGADFSLRNPQELAKLKKENLVEVWSKAEEIVKACFAKRPNYNDLIPIML
EIGVCDELLIRCGLALHIPLRPMLGSITRDLSEMLTKLQGRDFSCEYKYDGQRAQVHCDD
QGKVTIFSRHLELMTDKYPDLVALIPKIRGEGVSSFIMEGEVVAVDQNTGDLKTFQTLAN
RARKDVVIGSVKIDVCLFSFDLMYLNGESLLDRPFRERRELLRGLFTEVPNQFTWVKSID
ATSQDSETVLEFFKSATDIKCEGIMVKILDNLPNPNLQSEVIEENDSAAPEAAPPPPTKT
TTKGKKKSAKDDPSPAEKKTRRKPLLATYEPDKRLDSWLKVKKDYSTTFDTLDLIPVAGW
HGQGRKAAWWSPILLACRNPESGSLEAVCKCISGFTDSFYKANKEFYSQDGPNTLGSKPR
YVEYTGGHPDVWFEPQEVWEMAFADITISPTYTAAIGLVSEDRGLSLRFPRFLKKRDDKG
IEEASTNDFLAGLWRKQEEKAPGPGKEVQDEGDEDE
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgggaactccggccaaaaagcgcaagcttaatagcgattccaaggcttcacctgccacc
tctcgcagtctggactatttctttggaaaacagaagcaagaccctcccaaagctgtgtcg
aatgcagagcaggccatcgatcataattgcgatatctcagatttgacggatgagcaattg
gcacggaagttgcaggccgaatgggaccaagaagatgatgcaacgaaggagatgcaggaa
aatactaaagcagacgccacagaaatacacgcggagctggcagacctgccggagcgaagc
aaacatactcctgcatcagagggcgccgatggagaagctcaagagccgtatgaacagccg
aatgatacaaaagcaaccccttttgtttttggggcaaagggcaagaatactctctcgcta
caatctgctggaacggcggaagatacaatatgctcgaatataactttcgacgagagccca
ttaactttcgatccctcaaaatatatcaaagacttacaaggacactgggctgcggaggga
ggcgatgcatcctatgcacttctcacaaggtgtttcgtcttagtcaatagtacacagagt
cgtatcaagattgtagatactcttgtgaatttgctcagagtgattattgagggtgaccca
agtagtcttctgcctactgtgtggctaagtaccaacgccatctctccgccgtacatttcc
ttggaacttggtcttggaggctccgccatatccaaggcattaaagaatgtttgtggctta
gacaataaatcactgaaagctctctacgataaagttggagatgctggcgatgttgcattc
gaggccaagaagaagcagagcttcactcttaggaagccaaagccactctccatcaagggt
gtgtatcaatcccttgtgaagattgccaacacccaaggaacgggaagcggtgagatcaag
caaagggtggtcgatcgacttctacaagatgctcggggtgctgaggagagtcgatacata
gtgaggacgttgtgtcaacatcttcgaatcggggcagtcaagacaactatgctcattgca
ttgtctcgtgcatttctcctatcacgcccacctggcgctgatttctcgctcagaaatccc
caagaacttgcaaagctaaagaaggagaatctagtagaagtctggtctaaagcagaggag
attgtcaaagcatgcttcgctaagcggcctaactacaatgatctcatacctatcatgctc
gagattggagtgtgtgatgagctactcattagatgtggtctagctctacacattccgcta
cgacctatgcttggtagcattactcgagatctgtctgagatgctcaccaaacttcaaggt
cgagatttcagctgcgagtacaagtacgatggtcaaagagcacaagttcattgcgacgat
cagggaaaggttaccatcttttcccgacatcttgagctcatgacagacaagtatccagat
ctggtagccttgatcccaaagattagaggcgaaggtgtctccagtttcatcatggaagga
gaagtagttgctgtcgatcaaaatacaggcgacctaaagacatttcaaacactggccaat
agagctaggaaagatgtagtaattggcagcgtgaagatagacgtctgcctattctcattt
gacctcatgtatctcaacggcgagtcgcttcttgaccgaccattccgcgaaagacgagaa
cttctcaggggactcttcacagaagttcccaatcaattcacatgggtgaagagtatcgat
gcgacctctcaagactcggagacagtcctcgagtttttcaagagcgcaacagacatcaaa
tgcgaaggcatcatggtcaagattctggacaatttaccaaatcccaaccttcaatccgaa
gtgatagaagaaaatgactctgcagcaccagaagcagctcctccaccaccaacaaaaacc
accacaaaaggcaaaaagaaatctgccaaagatgacccctctccagccgaaaagaagacc
cggcgcaaaccgcttcttgctacgtacgaaccagataaacgcctcgactcctggctcaaa
gttaaaaaggactactctaccaccttcgacacattggacttaatccccgtcgcaggttgg
cacggccaaggccgcaaagccgcttggtggtcacctatcctcctcgcctgccgaaatcca
gaatccgggtctttggaagccgtctgcaaatgcatatccggcttcaccgactcattctac
aaagccaacaaagaattttactcccaagatggcccaaacacattaggatccaaaccaaga
tacgtcgaatatactggaggacatccagatgtatggtttgagcctcaagaagtgtgggag
atggcgttcgcagatatcacgatcagtcctacgtatacggctgccattggcttagtgagt
gaagatcgtggattgtcgctgagatttccgaggtttttgaaaaagagggatgataagggg
attgaggaggcgagtacgaatgattttttagcggggctgtggaggaagcaggaggagaag
gcacctggtcccgggaaggaggtccaagatgagggtgatgaggatgagtaa

DBGET integrated database retrieval system