KEGG   Phialocephala scopiformis: LY89DRAFT_631047Help
Entry
LY89DRAFT_631047  CDS       T04865                                 

Definition
(RefSeq) glycosyltransferase family 2 protein
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
psco  Phialocephala scopiformis
Pathway
psco00510  N-Glycan biosynthesis
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    LY89DRAFT_631047
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:psco01003]
    LY89DRAFT_631047
Enzymes [BR:psco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     LY89DRAFT_631047
Glycosyltransferases [BR:psco01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   LY89DRAFT_631047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21
Motif
Other DBs
NCBI-GeneID: 28820989
NCBI-ProteinID: XP_018061849
JGI: 631047
UniProt: A0A132B6I0
LinkDB All DBs
Position
Unknown
AA seq 243 aa AA seqDB search
MATKDKYSIILPTFNERRNLPIITWLLNRTFTEQKLDWELIIVDDGSPDGTQIVANQLVK
AYSPHVVLKPRAGKLGLGTAYVHGLQFVTGNYVIIMDADFSHHPKFISRMIAKQKELHTN
GGYDIITGTRYAGDGGVFGWDLKRKLVSRGANLFADTVLRPGVSDLTGSFRLYKRAVLQK
VIESTESKGYTFQMEMMVRAKAMGCTVAEVPITFVDRLYGDSKLGSSEIAEYATGVLRLW
MKV
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccaaagacaaatactccatcattcttccaacgttcaatgagcgtcgcaatcta
ccgataatcacttggcttctgaatcgaactttcaccgaacagaagctcgattgggagctt
attatcgttgatgacggctccccagatggcacccaaattgttgcaaatcagctggtgaaa
gcatactccccacatgtcgtcttgaagccgcgggcaggaaagctgggtttgggaacggca
tatgtgcacggattgcaattcgtcacaggaaactatgtcattatcatggatgccgacttc
tctcaccatcccaaattcatttctcgaatgatcgccaagcagaaggagcttcatacgaac
ggtggatatgacataatcactggtactagatatgctggagatgggggcgtttttggatgg
gatttgaaacgaaagctggtctcccggggtgcaaacttgtttgcggacacagttcttcga
ccaggagtcagtgatttgacagggagcttcagattatacaaacgggctgtgctgcagaag
gttatcgagagcacagagagcaagggatatacattccaaatggagatgatggttagggcg
aaagctatgggctgcactgttgcggaggttccgataacatttgtcgaccgtctgtatggg
gactcgaaattgggatcatcagaaattgctgaatatgctactggggtcttgagattgtgg
atgaaggtctaa

DBGET integrated database retrieval system