KEGG   Phialocephala scopiformis: LY89DRAFT_638079Help
Entry
LY89DRAFT_638079  CDS       T04865                                 

Definition
(RefSeq) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco00730  Thiamine metabolism
psco00790  Folate biosynthesis
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LY89DRAFT_638079
   00790 Folate biosynthesis
    LY89DRAFT_638079
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psco04147]
    LY89DRAFT_638079
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:psco00537]
    LY89DRAFT_638079
Enzymes [BR:psco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LY89DRAFT_638079
Exosome [BR:psco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LY89DRAFT_638079
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:psco00537]
 Enzymes
  LY89DRAFT_638079
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 28821283
NCBI-ProteinID: XP_018076330
JGI: 638079
UniProt: A0A194XP05
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MAPNEPLFADRRGSSIHSEERAADEDTALLTGQKSFSAPQNRSHFWREVGLFTWAVIATA
AVIVLAVLSQHQTTSEDGKNSKPAGKRNLIFMVSDGMGPASLSMTRSFRQFQGSLPYGDV
LVLDQHFIGSSRTRSTSSYVTDSAAGATAFSCGLKSYNGAISMLPDQTPCGTVLEAAKRA
GYMTGLVVTTDITDATPACFASHVRLRSEEDSIAQQEVGEHPLGRVVDLMLGGGRCHFLP
NTTDGSCREDDRDITKLAQESFGWNYIDSRKDFDNLKLGYNVELPLLGLFAEHDIPYEID
RRNMNDVYPSLEEMARTALNALTAATKDSEKGFFLMIEASRIDHAGHGNDPAAQVNEVLG
YDRAFATVVEFLDESEVEGVLVATSDHETGGLSVARQLHPEYPHYGWYPQVLANVSHSAS
YLSSQLRSHIGQTVDHSNSLEDDETRKASLEKYINEELVQKGLGIQDATPEEIQRVIDIP
LLSSYTFADMVSRRAQIGWSTHGHSAVDVNIYGSKGTDALHGNHENTEVGEFLRNYLELD
VQSVTDELIEKSTTITTSNSGNWFGRVPSEEEIQSASRHYERLYPEAP
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggctccgaacgaacctctatttgcagacaggagggggtcctcgatacattccgaggaa
cgcgccgcagacgaagacacagctcttttgactggacaaaaatccttctcagctcctcag
aatcggtctcacttctggagagaggttggattatttacctgggcagtcatcgcaactgct
gcagtcattgttctagctgtattgtcccaacaccaaacaacgtctgaggatggcaagaac
tcgaagcctgcaggaaagcggaatctgatcttcatggtctctgatggaatgggtcctgcg
agtttgtcaatgactcgaagcttcagacaatttcaaggttcccttccctacggcgatgtc
ctggttctcgatcaacactttatcggatcctctcgcactagatcaacaagcagctatgtt
acggactcggcagcgggtgcaacggccttttcttgtgggttgaagagctataatggagct
atttccatgctccctgatcaaacaccttgcggcactgtacttgaagctgcaaagagggct
ggctacatgactggtctggtggttacaacggacattacagatgcaacacctgcttgtttt
gcatctcatgtcagattaaggtcagaagaggactcaattgcccagcaagaagttggagaa
catcctcttggacgagtggttgatctcatgcttggaggaggtcgttgccatttcttacca
aataccactgacggcagttgtcgcgaggacgatagagatatcacaaaacttgctcaagaa
agcttcgggtggaactacattgacagccggaaagatttcgataatctgaagcttggctat
aacgttgagctgccgttacttggactctttgctgaacacgatattccgtatgaaattgat
cgacgcaacatgaacgatgtatacccttcactggaggagatggctcgaactgccttgaat
gctcttaccgctgcgaccaaggacagcgaaaagggattttttctcatgatcgaagctagc
agaattgatcatgctggtcacggcaatgaccctgctgcacaagtcaatgaagttctcggt
tatgaccgagcttttgcaaccgttgtggaatttctagacgagtccgaggtagaaggagtc
ctcgtggcaacttccgatcatgaaactgggggtctttctgttgcgagacagttgcaccca
gaatatcctcactatgggtggtatcctcaagtcctcgctaacgtttctcactctgcctct
tatctttcttcgcagcttcgatcacatatcggtcagacggtcgatcacagcaatagtctt
gaagatgatgaaactcgaaaggccagcctagagaagtacatcaacgaggaactagtccag
aaagggctgggtattcaagatgccactccggaggagatccaacgagtaatagacatcccc
cttctcagttcctacacttttgcggatatggtcagtcgtcgagcacagattggctggtca
acccatggtcattcagcagtcgatgtcaacatttacggctcgaaaggtaccgatgctcta
catggcaatcacgagaacacggaggttggagaatttctgaggaattacctcgaattggat
gtccaatctgtgaccgacgagttgattgagaagtcaacgaccataacaacttcaaattct
ggcaattggtttggacgcgttccctcagaggaagaaatccagtcggcctcaagacattac
gagcgcttatatcctgaagctccttga

DBGET integrated database retrieval system