KEGG   Phialocephala scopiformis: LY89DRAFT_638376Help
Entry
LY89DRAFT_638376  CDS       T04865                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:psco00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LY89DRAFT_638376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:psco03400]
    LY89DRAFT_638376
Enzymes [BR:psco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LY89DRAFT_638376
DNA repair and recombination proteins [BR:psco03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     LY89DRAFT_638376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase BRCT_2 BRCT RTT107_BRCT_5 DNA_ligase_IV
Motif
Other DBs
NCBI-GeneID: 28821298
NCBI-ProteinID: XP_018076509
JGI: 638376
UniProt: A0A194XQ22
LinkDB All DBs
Position
Unknown
AA seq 995 aa AA seqDB search
MASQREPDDEAIQDDELQYGHGPMTMEELDDKYGGDEDTPRPRNHSKTPPFSELLVSLFN
PLNDNKKRPTGPKVVAKKGPGSKTVSPHEQRRNIIQQFILRWRSQVGNDFYPALRLILPE
KDRDRPMYGLKEKAIGKLIVKMLKINANGDDAQSLLNWKLPGQTTASRMAGDFAGRCFEV
LSKRAMRQDFGDMRIAEVNELLDRLSAVSKEEDQLPIFSQFYNRMNADELLWLIRIILRQ
MKVGASEKTILEMWHPDGEILFNVSSSLRRVCWDLWDPSIRLDDDRRGIELMSCFQPQLA
QFSQHSIQKMIERMGCTSDNPEFWIEEKLDGERMQLHMKPDPNVKGGRKFAFWSRKGKDY
TYLYGSSLEDQNSSLTRFLKDAFDPGVESIILDGEMITWDPVTRSMVGFGTLKTAAISEQ
RNPYGETGHRPLFRIFDCLYINDKDITGFMLQDRREALERVVKNVDMRLEIHKYQVAATA
AEVETELRKVIEEASEGLVLKNPRSVYRLNSRNDDWMKVKPEYMTEFGESLDCVVIGGYY
GSGHRGGMLSSFLCGLRVDDNAIKAGADPMKCLSFFKVGGGFRAEDYAKVHHKTEGKWRK
WDRNNPPRDLIVLGGNDNQQFERPDEWIKPCDSVVLEVKAASVAASDHYGYQYSLRFPRF
KKLRDDKSWKEALSTYEFVELKSRVEEESKNKALKIDTSRRASKRLKKEVLIAGNNTKIR
TPYAGPQTKAFEGLSFWVMTGKEDQPKKTKAEMEQIIKSNGGKIVQSSTATDSVICIGDK
RVVKVASLIKSGETNIVKPAWVLDALKQVEIDGAERQRFLIPSEPAHMYHMLEEVREHIE
GAVDDYGDSYARDVNVDDLRRLMEDMIHPKDSEFSATEFLSELEERGKGFGEVPGSMFRR
CVARFVPANDETSGIDLEIAKNQFLFAGGTIAGDDEDDSITHYIVTSTDSKLVRDLRKSI
SRGSLRIPRIVSLSWLSDSWKEKTVLDEEQYAIVV
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggctagtcaaagggagccggatgatgaggccatccaagacgatgagcttcagtacggt
catggcccaatgaccatggaagagcttgatgacaagtatggtggtgacgaagatactcca
cggcctcggaatcattccaaaacacctccattctcagagctgctagtatctctcttcaat
cctctcaatgacaacaagaagcgacctactggccccaaagttgttgcaaagaaaggcccc
ggatcaaagaccgtatcgccgcatgagcagcggcgcaacattatccaacagttcatctta
cgatggcgcagtcaggttggcaatgacttttaccccgctcttagactcatcttgcctgag
aaggatcgagacagaccaatgtacggtctcaaagagaaagcgattggcaagttgatcgtc
aagatgctcaagatcaatgccaatggcgatgatgctcaaagtctgctcaattggaagcta
cctggtcagaccactgcaagtcgtatggcaggtgattttgctggaagatgtttcgaggtt
ctatccaaacgagcaatgcgacaagattttggggacatgcgaattgctgaggtgaacgag
cttctcgacagactttcagctgtctcgaaggaggaagaccaattgcctatcttctcgcaa
ttctataacagaatgaatgcagacgaacttctttggctgattcgcatcatccttcggcaa
atgaaggtgggcgcatctgaaaagaccatattagagatgtggcatcccgatggggaaatt
ctcttcaacgtctcttcaagcctgaggcgagtatgctgggacctctgggatccatcaatt
cggcttgatgatgatcggaggggcattgagttgatgtcatgttttcagcctcaactagca
cagttctcacaacattcaatccagaagatgatcgaaagaatgggttgcacctctgacaat
ccggaattctggatcgaagagaaattagatggcgagcgcatgcagctacacatgaaacca
gaccccaatgtcaagggaggacgaaagtttgctttttggtctcgaaagggtaaagactat
acgtatctgtacggaagtagtctcgaagaccaaaattcgtccctaacaaggtttctcaaa
gatgcctttgatccgggtgttgagagtataattctagacggcgagatgatcacctgggac
ccagtgacaagatccatggttggcttcggaacgctcaaaaccgcagctatatctgagcag
cggaatccttacggagaaacaggacatcgacctttgtttcgcatctttgactgcctttac
atcaacgacaaagacattacaggcttcatgttacaagataggcgcgaggctctagaacgt
gttgtcaagaacgttgatatgcgcctagagattcacaagtaccaagtggcagcgactgca
gcagaagtcgagactgaacttcgcaaggttattgaggaggcatctgaaggacttgtgttg
aagaacccacgatctgtgtaccgcctaaacagccgtaatgacgactggatgaaggtcaag
cctgaatatatgactgaattcggagagtccctggattgtgttgtgattggaggatactat
ggttccgggcatagaggtgggatgctgtcctcgtttttgtgcggcctccgcgtggacgat
aatgccatcaaggcaggtgctgatccaatgaagtgcttatctttcttcaaagttggtggc
ggtttccgagctgaggactacgccaaagtccatcacaagactgagggcaaatggcgtaaa
tgggacaggaacaaccctccgcgagatctcattgtccttggaggcaacgataatcagcaa
ttcgagcgacctgatgagtggatcaagccatgtgactctgttgttctggaagtcaaggca
gcatctgttgcggcgtcggatcattatggataccaatacagtttgcgattccctcgattc
aagaagctaagggatgataagagctggaaagaagcgctttcgacttacgaatttgtggag
ctgaagagccgtgttgaggaagaatctaagaacaaggcactaaagatcgataccagtagg
agagcctcgaaacgtttgaagaaggaagtgttgatcgctggcaataatacaaaaataagg
acgccttacgcaggacctcaaaccaaagctttcgaaggtttaagtttttgggtcatgact
ggcaaggaagatcagccgaaaaagaccaaggcagagatggagcagatcatcaagagcaat
ggcgggaaaatcgtccagagttcaactgcaacggatagtgtcatttgcatcggcgacaaa
agagtggtcaaggtcgcaagtcttatcaaaagtggagaaacgaacattgtaaagcctgct
tgggttcttgatgccttgaagcaagttgagattgatggcgctgagagacaacggtttctc
ataccttcggagccggcgcatatgtaccatatgctggaggaggtgcgcgaacacatagaa
ggagctgttgatgattatggcgacagctatgcgagagacgttaacgtcgacgacctcaga
cgccttatggaagacatgatacaccctaaggactcagaattctcagcaacagaattcctc
tcggagctcgaagagcgcggaaaaggctttggagaggtcccaggttccatgttcaggaga
tgtgttgctcgttttgtacctgcgaacgatgagacatctggcattgatttggagattgcc
aagaaccaatttctgtttgctggtggtaccatcgcgggagatgatgaggacgacagcatt
actcattacattgttacgagcacggattcaaagcttgtgagggatttacgaaaaagtatt
tcacgtggaagtttgaggatacctagaattgtcagtttgagctggctgagtgatagttgg
aaggagaaaactgttctagacgaagagcagtacgccatcgttgtttga

DBGET integrated database retrieval system