KEGG   Phialocephala scopiformis: LY89DRAFT_644385Help
Entry
LY89DRAFT_644385  CDS       T04865                                 

Definition
(RefSeq) glycoside hydrolase family 31 protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
psco  Phialocephala scopiformis
Pathway
psco00052  Galactose metabolism
psco00500  Starch and sucrose metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LY89DRAFT_644385
   00500 Starch and sucrose metabolism
    LY89DRAFT_644385
Enzymes [BR:psco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     LY89DRAFT_644385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 28821564
NCBI-ProteinID: XP_018072670
JGI: 644385
UniProt: A0A194XDQ6
LinkDB All DBs
Position
Unknown
AA seq 931 aa AA seqDB search
MEDSESMAFFMSLVLAVTVVSAAILPRAETDDPLASCPGYEASNVKTTASSLTVELGLAG
TACNVYGTDLTSLTLEVVYETDDRIHVKIEDAGNSVYQIPASVLPRPTASSGIDSKQANI
QFNYIASPFSFSITRPKTGEVLFDTSAASIVFESQYLRLRTSLPEDPNLYGLGEHSDPFR
LNTTDYIRTLWSQDAYGIPTGANLYGNHPIYFDHRTTGTHGVFFVNSNGMDIKINNTNGA
DQYLEYNTLGGVLDFYFMAGPTPVAVSQQYAEVVGLPAMMPYWGFGFHNCRYGYQDAFAV
AEVIYNYSKAEIPLETMWTDIDYMDRRRVFSLDPERFNLTMMQDINHYLHAHDQKQILMV
DPAVAYQQYGPYLRGAADEIFLKRSNGSFWLGVVWPGVTVFPDWFNTGIQGYWDNEFEVF
FSPETGVDVDGLWIDMNEPSNFPCNFPCDNPYAAAVGYPPDPPAVRTPPRPIPGFPCDFQ
PPGTPCTGTKVRREISQAVEESVMKIAERQAAGQELGLPGRDLLYPKYAIHNAAAFTYAD
NAARGGISNHTVNTDVIHQNGLAMYDTHNLYGTMMSTASRNAMQNRRSTERPIVITRSTF
SGAGTKVGHWLGDNISDWPHYRISIAGMMAFASIYQVPMVGSDVCGYGDNTTEQLCSRWA
TLGAFSPFYRDHNAYPPNIPQEFYQWESVTEAAKTVIDIRYRLLDYIYTALYHQTADGTP
LINPMFYIYPEDANTFGLDLQYFFGPSILVSPVTEENFTTASVYFPKDIFYDWYTHAPVQ
GQASTVAITDVNYTSIPLHYRGGIIVPQRVASAMTTTALRQQDFEIVVPLGADGKAEGEL
YLDDGISLVQAATTYVKFSFDGRTFSVKGSYGFDAGVKVARITFLGWSGSPSGCVVDGES
VGGWSHDRGTGELVVPVGKALSGDFEVVVNH
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggaggattcagagagtatggctttctttatgagcttggttttagctgtgacggtggtt
tcggcggcgattttgcccagagctgagacggacgatccgttggcttcttgtccgggttat
gaagcttcgaatgtgaagacgacggcttcgagcttgactgtggagctcggtcttgctgga
actgcttgcaatgtttatggcactgacttgacgagtcttacattggaggttgtttatgag
actgatgatcgaatccacgtcaagattgaagatgctggcaacagcgtttatcaaattcca
gccagtgttcttccaaggcctactgcatccagtggtatcgattccaagcaggcaaatatc
cagttcaactacatcgcctcgccattctcattctccatcactcgccccaagacaggagaa
gtgctcttcgatacttcagccgcaagcatcgttttcgagtcccaatacttacgactaaga
acctcattgccagaagacccaaatctgtacggccttggagaacactctgatcccttccgt
ctcaacaccacggattacatccgtacactctggtctcaagacgcatacggcatccccaca
ggcgcgaatctatacggcaaccacccaatctacttcgatcatcgcacgacaggtacccat
ggagtattcttcgtgaattccaacggcatggatatcaaaatcaacaacacgaatggcgcg
gatcagtacctcgaatacaacaccctcggcggcgtcctggacttctatttcatggccgga
ccaacacccgttgccgtctcgcagcagtacgcggaggtagtgggcctaccggctatgatg
ccgtactggggcttcgggttccataattgtaggtatgggtaccaagatgcgtttgctgtc
gcggaggtcatttataattactcgaaggcggagatcccgctcgagacgatgtggacggat
atcgattacatggatcgtcgacgggtattctcgctcgacccagagaggttcaacctcacc
atgatgcaggatattaatcattacctgcacgcacacgatcagaaacagatactgatggtt
gatcccgcagtggcgtaccagcagtatggaccctatttaagaggtgcggctgatgagatc
tttttgaagaggagtaatgggtcgttttggttgggggttgtgtggccgggtgtgacggtc
tttccggattggtttaatacggggattcaggggtattgggataatgagtttgaggttttc
ttttcgccggagacgggcgttgatgttgatggtctttggattgatatgaacgaaccgtca
aacttcccatgtaactttccttgcgacaacccttatgctgcggcagttggatatcctcca
gatcctccagctgtccgaactcctccacgtccaatcccggggtttccttgtgatttccag
cctcctggaacaccatgcactgggacgaaagtgagaagggaaattagccaagctgtcgaa
gaatcggtgatgaagatagctgagaggcaagctgctggacaagaacttggtcttcctggt
agagatctactttaccccaagtatgcgattcataatgctgctgcttttacgtatgcggat
aatgcggctcgtggaggaatctctaatcatactgttaataccgatgtcattcatcaaaat
ggtttggctatgtatgatactcataatctttatgggacaatgatgtctaccgcatccagg
aatgcaatgcaaaatcgaagatctacagaaagaccaatcgtcattacccgaagcacattc
tcaggtgcagggactaaggtcggacattggcttggagacaatatcagtgattggccacat
tacagaatttcgattgctggtatgatggcctttgcttcaatataccaagtcccaatggtc
ggttcagatgtttgcggatacggagacaacaccacagagcaactttgctcccgttgggcc
accttaggagcattcagtcctttctaccgcgaccacaacgcctacccacccaacatcccc
caagaattctaccaatgggaaagcgtaaccgaagccgccaaaacagtcatcgacatccgc
taccgtctcctcgactacatctacacagccctctaccaccagacagccgacgggactccc
ctcatcaaccccatgttctacatctaccccgaagacgccaacaccttcggtctcgacctc
caatatttcttcggcccctccatcctcgtctcgcctgtcacggaagaaaactttactacg
gcatcagtctattttcccaaagatatcttctacgactggtacacgcacgctcccgtccaa
ggccaagcatcaaccgtcgccatcacagacgtaaactacacctccatccctttgcactac
cgcggcggcatcatcgtccctcagcgcgtagctagcgctatgacaacaacggccctccgc
cagcaagatttcgagattgtggtcccgctcggcgcggacgggaaggcggagggagagctg
tatctcgatgatgggatctcgcttgtgcaggcggcgacgacgtatgtcaagttctcgttt
gatgggaggacgtttagtgttaaggggagctatgggtttgatgctggggtgaaggtggcg
aggattacgtttttggggtggagtgggagcccgagtgggtgtgtggttgatggggagagt
gtgggtggttggtcgcatgatagggggacgggggagttggttgtgccggtggggaaggcg
ttgagtggggattttgaggtggtggttaatcattag

DBGET integrated database retrieval system