KEGG   Phialocephala scopiformis: LY89DRAFT_683518Help
Entry
LY89DRAFT_683518  CDS       T04865                                 

Definition
(RefSeq) putative uridine nucleosidase
  KO
K01240  uridine nucleosidase [EC:3.2.2.3]
Organism
psco  Phialocephala scopiformis
Pathway
psco00240  Pyrimidine metabolism
psco00760  Nicotinate and nicotinamide metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LY89DRAFT_683518
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LY89DRAFT_683518
Enzymes [BR:psco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.3  uridine nucleosidase
     LY89DRAFT_683518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-GeneID: 28824445
NCBI-ProteinID: XP_018072931
JGI: 683518
UniProt: A0A194XEK2
LinkDB All DBs
Position
Unknown
AA seq 365 aa AA seqDB search
MMYDAFAILMSAYHPSLNLLGITTVHGNSSLPHTTHNALSLLTAIGAPSIPVYPGSANGL
TRPAVHAPAIHGASGLDGTTLLPTPINTHATEPFIEAMSTALLSTPKGTAWLIATGALTN
IALLFEQHPEVAEHIKGLSLMGGAIGGGFTNAPMGKVDDRERIGNWSAWAEFNILVDPEA
AQALFSNPVLRTKMVMIPLDVTHLVLATGEVQSLLLHGKGGGAASVLEDGKVGEGKSTLR
KMLVELLLFFAKTYKDVFGIEEGPPLHDPLAVAVILDGIAGAEIPFYDFEDGKDRKERYD
VHVVTEGSHEEAQNGAETGRTIVKLLPEGEEGVKIPRNLDVKRFWGVLEDSLERANAVNR
ANGVS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgacgcgttcgccatcctcatgtccgcctaccacccctcactcaacctccta
ggaataaccaccgtccacggaaactcatccctcccacacacaacccacaatgccctctcc
ctcctaacagctatcggtgcgccctccatccccgtctaccctggctccgcaaatggcctc
acccgtcccgctgtgcacgccccagcaatccacggcgcatctggtctagacgggaccact
ctccttcccaccccaatcaatacccacgccacggagccattcatcgaagccatgtccacg
gctctcctctccacgcccaaaggcacagcttggttaatagccacaggggcactaaccaac
atcgccttgttattcgagcaacatccagaagtagcggagcatatcaaaggactaagtctc
atgggcggcgcgataggaggtgggttcaccaatgcaccgatggggaaagtggacgataga
gaaaggattgggaattggagcgcgtgggctgagttcaatatcctcgttgaccctgaagcc
gcacaggcattgttctcgaatccggtgttgaggactaagatggttatgattccgttagat
gttacgcatctcgtgcttgctacgggagaggtgcagagtttgttgttgcatgggaaagga
ggcggtgccgccagtgttttggaggacgggaaagtaggcgaggggaagagtacattgagg
aagatgctggttgagcttttgcttttctttgctaagacgtataaggatgtgtttgggatt
gaagagggcccgccgttgcatgatcctcttgcagtagctgttattttggatggaattgcg
ggagctgagattccgttctatgactttgaagatggcaaggacaggaaggagaggtatgat
gtccatgttgtcactgaaggaagtcatgaggaggcacagaatggtgcagagacagggagg
acgattgtgaagctgctgccagaaggcgaggaaggggtcaaaattcctagaaacctggat
gtcaagcgattttggggcgttctggaagacagtttagagagggcaaatgcggtcaataga
gccaacggggtttcatga

DBGET integrated database retrieval system