KEGG   Phialocephala scopiformis: LY89DRAFT_690365Help
Entry
LY89DRAFT_690365  CDS       T04865                                 

Definition
(RefSeq) cupper/zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:psco00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LY89DRAFT_690365
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LY89DRAFT_690365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 28825810
NCBI-ProteinID: XP_018063674
JGI: 690365
UniProt: A0A132BBD9
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MVKAVATVRGDSKISGTVTFEQESESSPTTITWDIKGNDPSAKRGMHVHQFGDNTNGCTS
AGPHFNPHGKTHGAPTDETRHVGDLGNFETDAQGNGKGSTTDKLIKLIGPESVIGRTVVV
HSGTDDLGQGGNEESKKTGNAGTRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagttgctaccgtccgaggagactcgaagatctctggaaccgttaccttc
gagcaggagtctgagagctcccccaccaccatcacttgggatatcaagggcaacgaccca
agtgctaagcgtggcatgcacgtccaccaatttggtgacaacaccaacggctgcacatcc
gctggcccccacttcaacccacacggcaagactcacggtgctcccacggatgagacccgt
cacgttggtgatttgggcaatttcgagaccgatgctcaaggcaatggcaagggttccact
acagacaagctcatcaagttgattggccctgagagcgtcattggccgcaccgttgttgtt
cactccggaactgatgatctcggccaaggtggcaatgaggagtccaagaagactggcaat
gccggtactcgacctgcttgtggtgttattggcatcgcagcttaa

DBGET integrated database retrieval system