KEGG   Phialocephala scopiformis: LY89DRAFT_694968Help
Entry
LY89DRAFT_694968  CDS       T04865                                 

Definition
(RefSeq) hypothetical protein
Organism
psco  Phialocephala scopiformis
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin GST_C GST_C_3 Zeta_toxin
Motif
Other DBs
NCBI-GeneID: 28826468
NCBI-ProteinID: XP_018074628
JGI: 694968
UniProt: A0A194XJD5
LinkDB All DBs
Position
Unknown
AA seq 613 aa AA seqDB search
METESILHQQLPSTYRALQPQAAQAIQHGQPHLGHHTLASQSGLDLTGLDDNDPVFHQDL
RLQDPNGHAFQNPHPFDRNHGHGQMHIPNDGSPHTPQQHGNSGQYGILTAGPVQHNAINR
LQEEDIFGNPEGGDQKSNGHLSTKIVVDPPNLAEWRQKLFNVDEMITLSEDEFQTYFPHV
DNVYSHRSTQRYKRKPFVSHYWDCRLKGRPPGTPKSNDPNKKKRKRTARERDLCDVKIKI
TEYFPGAMLRADFVPDGGQVQQDPSQSNNFFAPGQPGNPGMNQQQQFGLPMVNTSLGPNH
PGATGQRYYTIQRVNGNGGNGKGDGVPGPHKHGLAESDRVKKNSVQRYVMKRDKEEKKTQ
KTYHKKASGAALATVRKHSKDHDFKLFGSCFCPFVQRVWIALEAKGLPYQYIEVDPYKKP
QALLDVNPRGLVPGIRHGDWGCGESTVLMEYLEDLNSGPPLLPPDPRHRATSRLWSDHIN
RRIVPAFYHLLQAQELNKQAENTKKLQDEIAKIVEQCDPQGPFFLGPHISFVDIQFAPWM
IRLNRVLKHYRGWPDPTPGSRWGRWLDAIETNEHVRNTTSSDDLYIDSYERYAQNRPNTS
ELADAVNGGLGLP
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggagaccgaatctattcttcaccagcagctccccagtacgtaccgggcattacagccg
caggcagctcaggcaatccagcatggccagcctcatctaggacaccatactctcgcatct
cagagcggcctcgaccttaccggcctcgacgacaatgaccctgtgtttcaccaagacttg
cgactgcaggatccgaatggacatgcatttcagaatccgcacccgttcgatcgcaatcat
ggacacgggcaaatgcatattcctaatgatggaagcccccataccccgcaacagcatggc
aatagtgggcagtatggtatcttgaccgcgggtccggtgcagcacaatgcaatcaacagg
ctacaagaggaggatatattcggtaacccagagggaggtgaccaaaagagcaatggacat
ttgagcacgaagattgttgttgatcctcccaacctcgcagaatggcgccagaagttgttc
aatgtggacgagatgattactttgagtgaggacgagtttcagacgtacttccctcatgta
gataatgtctattcgcaccgatcaacccagcgctacaaacgtaaacccttcgtttcccac
tactgggactgtcgtctcaagggcagacccccaggaacgccgaagtcgaatgacccaaac
aagaagaagcggaagcggacggcaagagagagggatctatgtgatgttaagatcaagatc
acggaatactttcctggtgccatgttgcgggcggatttcgtaccagatggaggtcaggtt
cagcaagacccgtctcaaagcaacaacttctttgcgccaggacagccgggaaatccagga
atgaaccagcagcagcaattcgggctccctatggtcaatacctctctggggccaaatcat
ccgggagccacaggccaacgctactatactattcaacgagtcaatggcaatggtggaaat
ggcaaaggcgatggtgtgccggggccacataaacatggcttggcagagagtgatcgtgtg
aagaaaaacagcgtccaaagatatgtcatgaagagagacaaggaggagaagaaaacccag
aagacatatcataagaaggcaagtggtgctgctttggctacagtcaggaagcattcaaag
gaccatgatttcaaattgtttgggagctgcttttgtcctttcgttcaacgagtctggatt
gctttggaggccaaaggcttgccatatcagtacatagaagtcgatccgtacaagaaacct
caagctttattggatgtcaaccctcgtggcttagtccctggcattcgtcatggggattgg
ggttgtggtgagagcacagttttgatggaatatttggaggatttgaactcaggacctcca
cttcttcctcctgaccccagacatcgagccacttcaagattgtggagtgatcacatcaac
cgaagaattgtgccagctttctatcatctgctccaagctcaagagctcaataaacaagca
gaaaataccaagaagctgcaagatgagatcgccaagatcgtagagcaatgtgatccgcaa
ggcccattctttcttggtcctcacatctccttcgtggacatccaattcgcaccttggatg
atccgattgaaccgagtcctaaagcactatcgtggctggccagacccaacgcctggcagt
agatggggacggtggttagatgcaatcgagacaaacgaacatgtcagaaacacgactagc
tcagatgacctctatatcgactcttatgagcgatatgcgcagaatcgtccgaatacttcc
gagcttgctgatgctgttaatggtggtctagggttgccttga

DBGET integrated database retrieval system