KEGG   Phialocephala scopiformis: LY89DRAFT_710350Help
Entry
LY89DRAFT_710350  CDS       T04865                                 

Definition
(RefSeq) succinate dehydrogenase
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco00020  Citrate cycle (TCA cycle)
psco00190  Oxidative phosphorylation
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01200  Carbon metabolism
Module
psco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psco_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY89DRAFT_710350
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LY89DRAFT_710350
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LY89DRAFT_710350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 28827548
NCBI-ProteinID: XP_018065606
JGI: 710350
UniProt: A0A194WTF9
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MSSFAMRKFTSGPSFSKALRNQTRQFSSTRPAARIITHAPLRAKEASPFVSNKYPVVDHE
YDAIVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPQSVIELENYGCPFSRTDDGKIYQRAFGGQSQKFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMEDGECKGVLAYNQED
GTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPDK
DHIYLQLSHLPPEVLHERLPGISETASIFSGVDVRKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDAEGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFEPGKP
LPEISADAGADSISVLDQVRQSSGPKSTHDIRLAMQKTMQTDVSVFRTQESLDEGVRKIN
EVDQTFKDVGIKDRSMIWNSDLVETLELRNLLTCAVQTAEAAAARKESRGAHAREDFPDR
DDKEWMKHSLTFQKKPHGKTDLSYRAVVGHTLDENECAAVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctttgcgatgaggaagttcacttctggtccttccttctcgaaggcattgaga
aatcagacaagacaattctcttcgacacgacctgcggcacgaattatcacgcacgcgcca
ctccgagcaaaagaagcttcaccattcgtcagcaacaaatatcctgtagtagatcacgag
tatgatgcgattgtcgtcggtgctggtggatcaggtctgcgagcagcattcggtcttgcc
gaggctggattcaacaccgcttgtatatccaagctcttcccaactcgaagtcatactgtt
gcagctcagggaggtataaatgcggctctagggaacatgcacgaggacgactggaggtgg
cacatgtatgatacagtgaagggttcggattggctcggagatcaagatgccattcactac
atgacaagagaagctccccagtctgttatcgagttggagaattacggttgccccttctca
agaacggatgacgggaaaatctatcaacgtgcttttggaggccaatcgcagaagtttggc
aaaggtggacaggcttatcgatgctgtgcagcagccgacagaaccggacacgctcttcta
cacacactttacggccaatcactacgacataatacaaactacttcatcgaatactttgct
ctcgacctgattatggaggatggagagtgcaagggtgttctcgcatacaaccaggaggac
ggaactttacatcgattccgagcacacaacactgtcttggccactggtggttatggacgt
gcatacttcagttgtacatctgcacatacttgcacaggtgacggtatggctatggttgct
cgtgccggtcttcccaaccaagatctcgaattcgtccaattccatcctactggtatctac
ggcgctggctgcttgatcaccgagggtgctcgtggtgagggtggataccttctcaactct
gagggtgaacgattcatggagagatatgccccaacagccaaggatttggccagtcgtgat
gtcgtttcccgatcgatgacgatggagatccgagaaggccgtggtgttggtccagataag
gaccacatctacctgcaactcagccatttgccacccgaggttctccacgaacgtcttcca
ggtatctctgagactgcttctatcttctctggtgtcgatgtccgaaagcaaccaattcct
gtgttgcccaccgtccactacaacatgggtggtatcccaaccaagtacacaggtgaggtt
ctcactgttgatgccgaaggtaaggaccaggtggttccaggtcttttcgcttgcggtgag
gctgcttgtgtctccgttcacggtgccaaccgtctaggtgccaactctctcctggatttg
attgtctttggtcgtgcagtctcacacaccatccgcgacaacttcgagcccggcaagcca
ctcccagaaatcagcgccgatgctggtgccgattctatcagtgttctcgaccaggtccga
caatcttctggaccaaagagcacacatgacattcgtctcgcaatgcagaagactatgcaa
actgatgtcagcgtgttcagaacacaagagtcactggacgagggtgttcgaaagatcaat
gaggttgatcaaaccttcaaggacgtcggtatcaaggaccgaagcatgatctggaactcg
gacttggttgagaccctcgaattgagaaacttgttgacttgcgctgtccaaactgccgag
gctgcagctgcgagaaaggagtcacgtggtgcacatgcgagagaggattttccagaccga
gacgacaaggaatggatgaagcacagtttaacgttccagaagaagcctcacggaaagacg
gatctctcgtacagagctgtggtgggtcatactttggatgagaatgagtgcgctgctgtg
cctcctttcaagcgtgtctactaa

DBGET integrated database retrieval system