KEGG   Phialocephala scopiformis: LY89DRAFT_719267Help
Entry
LY89DRAFT_719267  CDS       T04865                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
psco  Phialocephala scopiformis
Brite
KEGG Orthology (KO) [BR:psco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:psco03036]
    LY89DRAFT_719267
Enzymes [BR:psco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     LY89DRAFT_719267
Chromosome and associated proteins [BR:psco03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     LY89DRAFT_719267
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 28828209
NCBI-ProteinID: XP_018070930
JGI: 719267
UniProt: A0A194X8S9
LinkDB All DBs
Position
Unknown
AA seq 1203 aa AA seqDB search
MSQHISDNNMSRETAPLPSSINNYDSTFAQSLKRLSISAASATALPSSPQSPHPGRTLGR
QDSSSASPNGRLPPRSPLHRSPSSMSQRSRSSTPTLLRKASLNSLHGVGGVTPSRTTPSR
RSSSAQFANASAMVGKSPLSEIEDPMPAPPRHTAESIASNHFRTELDIHEKEDEARSADT
VVILHDSCYGHRYSRPRTSKASLSTIVERPERIHASILGLSVAYVRLGERHAEGQYPLHP
DKDASSIPTIPFRICKTTRRLALGSQAVTNVHGMKWMEELKIMCDNAESRLAMNGKELVR
PDMVRSPDQEVAKLHEGDLYLCAESLDAMEGALGAVCDGVDAVFQGAASGKGPHRTFVAI
RPPGHHCSASYPSGFCWLNNVHVGISHAALTHGLTHAAIIDFDLHHGDGSQAIAWDANKR
AIGAAKNAAQWKKTSIGYFSLHDINSYPCEMGDEEKVKNASLCIENAHGQSIWNVHLQPW
KSEIEFWQLYETKYSILLEKTRNYLRAQTDRLRMIPNGPKPKGAIFLSAGFDASEWESSG
MQRHKVNVPTEFYARLTRDVVKLAAEEGNACDGRIISVLEGGYSDRALCTGVLSHLSGMS
AGDPIIIKKELSPNGLGYEMGQKINTFEGVFAKEDVTVGTQTYDKLWWSVPRLEQLDALI
RPTPMVEPKKPRDATAPTYSSPTQSFIAKVTSPEARRTVSRMGISNGSPKPVSRAPSPPP
PEVDWTVAAHELSKLLIPIDRQTMSCRPEDLSAEATRVRRDRQSILTPPTSAAPEPTEGS
GRMALRTRKPRALAETIEEDEKPATKANRRKTVAGAAVIAAEKAVSRSTTPMPEPSYAKG
TTQSNRRLSLSSNAGSVTSEVPRQNGHRASSGSGPVGASRPGTAQSTRPDTSMSSRGGSI
PPIAMKKTRAPAVARGEAPKTSRVRKKSPLNETNAVPGPSGSVQPTSRSSSVVLPTTEIP
DSQGSDMDSLTSGMKKVKISLTTKAQREAKQAAKPAPVKSTAGKAVKPRPAEGKVTDQPP
ILPGMKPVPVSEAVPSSANGTTTEQPVEQVLAPTPSTPQPSLPAVAPALQASEVPLPSSS
PAAPQYSPITPAPEFIAPIYSAPPSDNFIPYQPEGPTPNPVTQQQHLHWLPPNTNTPSPV
KRGDLPVFTSTSAIPFGLNPRTNGEIKKDATEDGKGKGKEEEKEVDIWAVPETPEAKRPL
GNY
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaacacatttcggacaataatatgtccagagaaactgcaccattgccgtcgtca
ataaacaactacgattcaaccttcgcgcagtcactgaaacgactttcaatctctgcagct
tctgctactgctttgccatcatcgcctcaatcaccccacccaggacggacattgggacga
caagatagctccagtgcttcgccaaatggacgattaccaccacgaagtcccctccatcgt
tctcccagctccatgagccaacgatcgcgttcgtcaactccaacactacttcggaaagcc
tcattgaattctttgcatggtgttggaggagttacaccttcaagaacaacgccgtctcga
cgctcatcttcagcgcaattcgcaaacgcttccgcaatggttggcaagtcacccctatca
gagatcgaagatccaatgcctgcccctccgcgacatactgcggaatcgatcgcgagtaac
cacttcaggactgagttggatatccacgagaaagaagacgaagctaggagcgcagacacg
gtggtgattctacatgattcttgttatgggcaccgttattccagaccacgaacatcgaag
gcttccttaagcaccatagtcgagagacccgagcgaattcatgcaagtatccttggtctg
tcagtggcctatgtacgactcggagagcggcatgctgaggggcaatatcccctgcaccca
gataaggatgcctcctcgattcctactatacccttccgaatttgcaagactacacggcga
ctggcgctgggatcacaagctgtgacgaacgtacatggaatgaagtggatggaggagctg
aagattatgtgcgacaatgctgaatctaggctggctatgaatgggaaagaactggtacgc
ccagatatggttcgcagtccagaccaagaagttgcaaagctacatgaaggagacttgtat
ctttgtgcggagtccttggacgctatggagggagcattaggggctgtttgtgatggtgtg
gatgctgtattccaaggcgctgcaagcggaaaaggaccacataggactttcgttgcgatc
agaccaccaggacatcattgctcagcaagctatccatctggcttttgttggctaaacaat
gttcatgttggaatatctcatgccgctctcactcatggcttgacccatgctgccattatc
gatttcgatcttcaccacggcgatggatcgcaagctattgcatgggatgcgaacaaacga
gctatcggtgccgccaagaatgctgcccaatggaagaagacatcaattggctatttcagt
cttcacgatatcaactcatatccatgcgagatgggtgatgaagagaaggtgaagaacgct
agcctttgcattgagaatgcacatggccaaagcatttggaacgttcatttgcaaccgtgg
aagagtgaaatagaattctggcagctgtacgagaccaaatactctatccttttagagaag
acgagaaactatttgagagctcagacagaccgcttaagaatgattcccaatggaccaaaa
ccaaagggagctattttcctgtcggctggattcgatgctagtgaatgggaaagctctgga
atgcaaagacacaaagtcaatgtaccaactgagttctacgctcgcctgacacgagatgtg
gtcaagcttgcagcagaagaaggcaatgcttgtgacggtagaatcatcagcgttcttgaa
ggcggatatagtgatcgcgctctatgcactggtgtactaagccatctgagcggcatgtcg
gctggtgacccaatcattatcaagaaagaacttagcccgaatggacttggctacgagatg
ggccaaaagatcaacaccttcgaaggtgtctttgcaaaagaggacgtcactgttggaacg
cagacttatgataaattgtggtggtcggttccacgccttgagcagcttgatgctttgatt
cgtcctacacctatggtggaaccaaagaagcctagagatgcaactgctccgacgtattca
tcgccgactcagtcgtttattgcaaaggtcacatctccggaagctcgtaggactgtctcc
agaatggggatatccaatggatcgccaaaaccagtttcacgagctccgtcgccgccacca
cctgaagtggattggactgttgctgctcatgaattgagtaagttgttgattccaattgat
agacagactatgagctgcaggccagaggacctttcagctgaagctacacgggtcagacgt
gaccgacaatctattctcacgccgcctacatccgctgctccagaacccacagaaggttca
ggtagaatggctttgagaacaagaaagcctagggccttagctgagactattgaggaagat
gagaagccagctactaaggctaatcgtcgaaaaactgttgctggtgccgcagtcatagct
gctgaaaaggccgtatcaagaagcacaactccaatgccagagccgagctatgctaaggga
actacgcagtccaatcgtcggctgagtctttcctccaatgcaggttccgtcacatcagag
gtgcctcgacaaaatggacacagagcttcttctggatctgggccagtgggagcctcaaga
cctgggactgcacaaagtacacgacctgatacatccatgagcagcagaggtggttctatt
cctcctattgctatgaagaaaactcgggccccagctgtagcacgtggtgaagccccaaag
acttctcgagttcgaaagaagtcaccattgaatgagaccaatgctgttcctggtccgtcg
ggctctgtccaaccaacttcaagatctagtagtgttgtgctacccactacagagatcccg
gactctcagggttcggatatggatagtctgacgtccggcatgaagaaggtcaagatcagt
ttgactacgaaggcccagagagaagcaaagcaagctgctaaaccagcacctgtaaaatcg
accgctggaaaagctgtcaagccccgtccggctgagggaaaggtaacggatcaaccacca
atcctgccagggatgaagccagtaccagtatcagaagctgtgccttcgtccgccaatggc
acgactactgagcagccagtcgagcaagtacttgcaccaacgccttctacacctcaacct
tcattaccagccgtcgctccagcactccaagcatccgaggttccacttccatcgagctcc
ccagccgcacctcaatattctcccatcactcccgcccctgaattcattgctccaatatat
tccgctcctccatccgacaacttcattccctaccaacctgaaggaccaacgcccaatcct
gtaacccagcaacagcatcttcactggctcccaccaaatacaaatactccttcgcctgtg
aagagaggtgatctgcctgtttttacgagcacgagcgctattccattcggtttgaaccct
cgaacaaatggagagattaagaaggacgctaccgaggatggcaagggaaagggaaaggag
gaagagaaagaggttgatatttgggctgtgcccgaaacgccggaagcaaagagacctctt
ggcaattactga

DBGET integrated database retrieval system