KEGG   Phialocephala scopiformis: LY89DRAFT_728973Help
Entry
LY89DRAFT_728973  CDS       T04865                                 

Definition
(RefSeq) succinate dehydrogenase and fumarate r
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco00020  Citrate cycle (TCA cycle)
psco00190  Oxidative phosphorylation
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01200  Carbon metabolism
Module
psco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
psco_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY89DRAFT_728973
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LY89DRAFT_728973
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LY89DRAFT_728973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_18 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 28829057
NCBI-ProteinID: XP_018077218
JGI: 728973
UniProt: A0A194XRP3
LinkDB All DBs
Position
Unknown
AA seq 288 aa AA seqDB search
MASLRATSRLFTAARPAFRQSIRSFASVSDTAKGGAVPPSKTSTIKEPTHDPEAKIKTFH
IYRWNPDEPTSKPRMQSYTLDLNKTGPMMLDALIRIKNEVDPTLTFRRSCREGICGSCAM
NIDGVNTLACLCRIPTDTKQESKIYPLPHTYVVKDIVPDLTQFYKQYKSIKPYLQNSTPP
PNGKEYLQSKEERKKLDGLYECILCACCSTSCPSYWWNSEEYLGPAVLMQSYRWLADSRD
TKNEERKSQLDNSMSLYRCHTILNCSRTCPKGLNPGLAIAEIKKEMAF
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtctcagagcaacctcacgcctcttcacggcggctcgcccagcattcagacaa
tcaattcgcagcttcgcatctgtatccgacactgcaaagggcggagctgtcccaccttcc
aagacctctacgatcaaagaacccacccacgatccggaggcaaaaatcaagaccttccac
atctacagatggaacccagacgagccaacctcgaagcctcgcatgcagagctataccttg
gatctgaataagactggacccatgatgttggacgctttgatcagaatcaagaacgaggtt
gatcccaccttgacattcaggcggagttgccgtgaaggtatctgcggaagctgtgctatg
aacatcgatggtgttaacacactggcctgcttgtgccgcatccctaccgacaccaagcaa
gaatcgaagatctaccctctcccacacacctacgtcgtgaaggacatcgtacctgatctt
actcaattttacaagcaatacaagtccatcaagccatatctgcaaaactccactcctcca
ccaaacggcaaggaatatctccagagcaaggaggagcgtaagaagctggacggtctctac
gaatgtattctctgcgcatgctgctcaacatcttgcccctcatactggtggaacagcgaa
gagtaccttggtcccgcagtcctgatgcagagctacagatggttggcagattcacgagat
accaagaacgaggagagaaagtctcaattggacaacagcatgagcttgtaccgatgccat
accattctcaactgctcgagaacatgcccgaaaggtttgaaccctggcttggcaatcgct
gagatcaagaaggagatggctttttaa

DBGET integrated database retrieval system