KEGG   Phialocephala scopiformis: LY89DRAFT_734920Help
Entry
LY89DRAFT_734920  CDS       T04865                                 

Definition
(RefSeq) putative isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
psco  Phialocephala scopiformis
Pathway
psco00020  Citrate cycle (TCA cycle)
psco00480  Glutathione metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01200  Carbon metabolism
psco01210  2-Oxocarboxylic acid metabolism
psco01230  Biosynthesis of amino acids
psco04146  Peroxisome
Module
psco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psco_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY89DRAFT_734920
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LY89DRAFT_734920
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LY89DRAFT_734920
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LY89DRAFT_734920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh DUF2543
Motif
Other DBs
NCBI-GeneID: 28829675
NCBI-ProteinID: XP_018070125
JGI: 734920
UniProt: A0A194X6G7
LinkDB All DBs
Position
Unknown
AA seq 416 aa AA seqDB search
MASSTSFKKIVVKNPVVELDGDEMTRIIWKDIKDKFIHPYLDIDLKYYDLGLEYRDETND
KVTTDSAEAILKYGVGVKCATITPDEQRVKEFNLKQMWLSPNGTIRNALGGTVFREPIVI
PRIPRLVPGWKKPIIIGRHAFGDQYRAKDLVVKGNGTLKMVFTPKGGKPEEIEVYEFKNG
GGVAQTQYNTDESITGFAHASFKLALAKGLPLYMSTKNTILKKYDGRFKDIFQEIYDKEY
KTGFEEKKIWYEHRLIDDMVAQMMKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVL
ITPDGKTFESEAAHGTVTRHYREHQKGNETSTNPIASIFAWTRGLVQRGTLDNTPEVVAF
AESLEKACIDTVDIDGIMTKDLALACGLSKREDWVTTGEYLSAVERRMKSLLKQKL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcagcacttccttcaagaaaatagtggtcaagaacccggtggtggagctagat
ggcgacgagatgacccgcatcatctggaaggacatcaaggataaattcatccacccgtac
ctggacatcgatctcaagtactacgacctggggctcgagtaccgggacgagacgaacgat
aaggtgacgacggatagtgcggaggcgatcttgaagtacggggttggtgttaagtgtgcg
acgatcacgccggatgagcagcgggttaaggagtttaatttgaagcagatgtggttgtct
cccaatggaacaatcagaaatgctcttggaggaaccgttttcagagaaccgatcgtgatt
ccccgaattccacgcctggttccgggctggaagaagcccattatcatcggtcgacacgca
ttcggagaccaataccgagccaaagacctcgttgtaaaaggcaacggcaccttgaagatg
gtattcacccccaagggtggaaagccagaagaaatcgaagtctacgagttcaagaacgga
ggcggggttgcgcagacgcagtataataccgatgagtcgattacggggttcgcgcatgcg
agtttcaagctggcgctggcgaagggactgccgctttatatgagtaccaagaatacgatt
ctgaagaagtatgatgggcggtttaaggatatcttccaggagatctatgacaaggagtat
aagaccgggttcgaggagaagaagatctggtatgagcacaggcttattgatgatatggtt
gcgcagatgatgaagagttctgggggatatattatggctttgaaaaattatgacggagac
gtccaatccgacatcgtagcccaaggcttcggctccctaggcctcatgacctccgtcctc
atcacgcccgacggcaagaccttcgaatccgaagccgcgcacggcaccgtgacccgacac
taccgcgagcatcaaaagggcaacgaaacatccaccaacccgatcgcctcgatcttcgcc
tggacgcggggactcgtgcagagaggaaccctggacaatacgcccgaggtggtggccttt
gccgagagtctcgagaaggcgtgtattgatacggtggatatcgatggtatcatgacgaag
gatttggcgctggcgtgtgggttgagtaagagggaggattgggttacgacgggggagtat
ttgagcgcggtcgagaggcggatgaagagtttgttgaagcagaagttgtag

DBGET integrated database retrieval system