KEGG   Pseudoxanthomonas spadix: DSC_01640Help
Entry
DSC_01640         CDS       T01643                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00010  Glycolysis / Gluconeogenesis
psd00620  Pyruvate metabolism
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
psd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DSC_01640
   00620 Pyruvate metabolism
    DSC_01640
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DSC_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AER54981
UniProt: G7UU92
LinkDB All DBs
Position
complement(144961..146490)
Genome map
AA seq 509 aa AA seqDB search
MNAVTSTKPLSTDPQSIFKPRYANFIGGKWVEPKGGEYFDNITPITGKVFTQIPRSGKDD
IEAALDAAHAAKTAWGETSATERSNILLRIADRIEQNLELLAYAETWDNGKPIRETLNAD
VPLCADHFRYFAGAIRAQEGGISQIDKDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPAGVLNIVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNVFFADVMAEDDDFLDKAVEGFVLFAFNQ
GEVCTCPSRALIQESIYDRFMEKALARVAAIKQGNPLDPNTMVGAQASGEQLEKILSYID
IGKQEGAQVLIGGEQNKLEGDLAGGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
EAVAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtcaccagcaccaagccgctgtccaccgacccgcagtccatcttcaagccg
cgctacgccaacttcatcggcggcaagtgggtcgagcccaagggcggtgaatatttcgac
aacatcaccccgatcaccggcaaggtcttcacccagatcccgcgctcgggcaaggacgac
atcgaggcggcgctggatgccgcccatgccgccaagaccgcctggggcgaaacctcggcc
accgagcgcagcaacatcctgctcaggatcgccgaccgcatcgaacagaacctggagctg
ctggcctacgccgagacctgggacaacggcaagccgatccgcgagaccctcaacgccgac
gtgccgctgtgcgccgatcatttccgctacttcgccggcgcgatccgcgcccaggaaggc
ggcatctcgcagatcgacaaggacacggtggcctaccacttccacgagccgctgggcgtg
gtcggccagatcatcccgtggaacttcccgctgctgatggcgtgctggaagctggccccg
gccctggccgccggcaactgtgtggtgatgaagcctgccgaacagaccccggcctcgatc
ctggtgctgatggaagtcatcggcgacctgctcccggccggggtgctcaacatcgtcaac
ggcttcggcctggaagccggcaagccgctggccagcaacccgcgcatcgccaagatcgcc
ttcaccggcgagaccaccaccggtcggctgatcatgcagtacgccagccagaacctgatc
ccggtgaccctggagctgggcggcaagtcgcccaatgtcttctttgccgacgtgatggcc
gaggatgacgatttcctggacaaggcggtggaaggcttcgtgctgttcgccttcaaccag
ggtgaggtctgcacctgcccctcgcgtgcattgatccaggagtcgatctacgacaggttc
atggagaaggcgctggcccgggtggcggcgatcaagcagggcaatccgctggaccccaac
accatggtcggcgcgcaggcctccggcgagcagctggaaaagatcctgtcctacatcgac
atcggcaagcaggaaggcgcccaggtgctgatcggcggtgagcagaacaagctcgagggc
gatctggccggcggcttctacgtcaagccgaccgtgttcaagggccacaacaagatgcgc
gtgttccaggaggagatcttcggcccggtggtctcggtgaccaccttcaaggacgaggcc
gaggcggtggccatcgccaacgacacgctctatggcctgggcgccggcgtgtggagccgc
gatgcctcgcgcctgtaccgcatgggccgcgcgatccaggccgggcgggtgtggaccaac
tgctaccacgcctatccggcgcatgccgccttcggtggctacaagcagtcgggcatcggc
cgcgagaaccacaagatgatgctcgaccattaccagcagaccaagaacctgctggtgagc
tactcgccgaagaagctcgggttcttctga

DBGET integrated database retrieval system