KEGG   Pseudoxanthomonas spadix: DSC_02080Help
Entry
DSC_02080         CDS       T01643                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
psd  Pseudoxanthomonas spadix
Brite
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DSC_02080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AER55069
UniProt: G7UUZ0
LinkDB All DBs
Position
238785..239423
Genome map
AA seq 212 aa AA seqDB search
MRLTCSLLCTATLLALTACSKPESNEAPEAVTEPVASTPASAPATSAPASSAPATSEAAM
AMAKATLKPTAGNTVAGELSFTAVDGGVRVTGTLSGLSPGEHGFHIHEKGDCSAPDGTSA
GGHFNPDGVDHGQVTADPHHAGDSNNLTASADGNVTVDQMLSANVDIGKGDKYDIVGKAV
IVHEKADDYKTQPTGDAGGRLACGVIEAAPAM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgacctgttccctgctgtgtaccgccaccctgctggcgctgaccgcctgcagc
aagcccgagtccaacgaggcgcctgaagcggtcaccgagccggtggcctcgaccccggcc
tccgcgccggcgaccagcgccccagccagcagcgctccggccaccagcgaggcggcgatg
gccatggccaaggccaccctcaagcccaccgcgggcaacaccgtcgccggcgagctgagc
ttcaccgcagtcgatggcggcgtgcgcgtcaccggcaccctcagtggcctgagcccgggc
gagcacggcttccacatccacgagaagggcgactgcagcgcgccggacggcaccagtgcc
ggcggccacttcaatcccgacggcgtggaccacggccaggtcaccgccgacccgcaccat
gccggcgacagcaacaacctcaccgccagtgccgacggcaacgtcaccgtcgaccagatg
ctgtcggccaatgtggacatcggcaagggcgacaagtacgacatcgtcggcaaggcggtg
atcgtccacgagaaggccgacgactacaaaacccagcccaccggcgacgccggcggccgc
ctggcctgtggcgtgatcgaggccgcaccggcgatgtaa

DBGET integrated database retrieval system