KEGG   Pseudoxanthomonas spadix: DSC_05265Help
Entry
DSC_05265         CDS       T01643                                 

Definition
(GenBank) integral membrane sensor signal transduction histidine kinase
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSC_05265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psd01001]
    DSC_05265
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psd02022]
    DSC_05265
   02035 Bacterial motility proteins [BR:psd02035]
    DSC_05265
Enzymes [BR:psd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DSC_05265
Protein kinases [BR:psd01001]
 Histidine kinases
  NtrC family
   DSC_05265
Two-component system [BR:psd02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   DSC_05265
Bacterial motility proteins [BR:psd02035]
 Pilus system
  Twitching motility proteins
   DSC_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 HATPase_c_2 PAS PAS_4
Motif
Other DBs
NCBI-ProteinID: AER55704
UniProt: G7UQ92
LinkDB All DBs
Position
complement(939621..941255)
Genome map
AA seq 544 aa AA seqDB search
MSTGPAKPPALALALALASAPRRELYSLALYRVLEAGILAGLLFSPLSDMLGASGNQSPM
LATWVTVFYLVFSLAMLILGRNEQHLLPIVMIGACADIAVASLITYALPEAAPGVAMLLL
FNVAAACSLLPLRWGIGVAVAATVAHFAEYLVALLGTNPDRPLAEVVMFCISYLAVGLLA
VQIGLRARRSQQLADDRGLEVANLVEVNELIIRRMRTGVLVVDLEGRIRLANEAATGLLG
SATEHPDSDTGTLLQNVAPELARRLQRWRNGWQNEEAPLALAPDQPDIQPRFARLLAGSE
LSLVFLDDATVVSRRAESLTLAALGRFSASLAHEIRNPLAAINYAVQLLEESREFNASDR
HLLGIIHQQCQRTNGIVESVLGLARRERAIPEHTDLNAFAQDFVYEYQQSMSIETDSLEA
VTGNRPVSALVDPRHLHQVLTVLVHNALNYGRMPGEPARIRLRVFQLDQRAMIDVLDRGP
GIPAAVAAQLFRPFFTTSEHGTGLGLYIARELCRANQATLEHVAVPGGGSCFRISMPGPN
TLLS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaccgggcccgcaaagccgcctgccctggccctggccttggccctggcctcggcg
ccacgtcgcgagctgtattccctggccctgtaccgggtgctggaagccgggatcctggcc
ggcctgctgttcagcccgctctcggacatgctgggtgccagcggcaaccagtcaccgatg
ctggccacctgggtgaccgtgttctacctggtcttctcgctggcgatgctgatcctgggc
cgcaacgagcagcacctgctgccgatcgtcatgatcggcgcctgcgccgacatcgcggtg
gccagcctgatcacctacgccctgcccgaagcggcccccggggtggccatgctgttgctg
ttcaacgtggctgcggcctgctcgctgctgccgctgcgctggggcatcggcgtggccgtg
gccgccactgtcgcgcattttgccgaatacctggtcgcgctgttgggcaccaatccagac
cgtccgctggccgaagtggtgatgttctgcatcagctacctggccgtgggcctgctggcg
gtgcagatcggcctgcgcgcccggcgcagccagcagctggccgacgaccgcggcctcgag
gttgccaacctggtcgaagtcaacgaactgatcatccgccgcatgcgcaccggggtgctg
gtggtcgacctggaagggcggatcaggctggccaacgaggcggccaccggcctgctgggc
agtgccaccgaacaccccgactcggacaccggcaccctgctccagaacgtcgccccggag
ctggcccggcgcctgcagcgctggcgcaatggctggcagaacgaggaagcgccgctggcc
ctggcgccggaccagcccgacatccagccccgcttcgcccgcctgctggccggcagcgag
ctgtcgctggtgttcctggacgatgccaccgtggtctcgcgtcgcgccgaatcgctgacc
ctggccgcgctgggccggttctcggccagcctggcccacgagatccgcaatccgctggcc
gcgatcaactacgcggtccagctgctggaggaatcgcgcgagttcaacgccagcgaccgg
caccttttgggcatcatccaccagcagtgccagcgcaccaacggcatcgtcgaaagcgtg
ctgggcctggcccggcgcgaacgtgccatccccgagcacaccgatctcaatgccttcgcc
caggacttcgtctacgagtaccagcagtcgatgtcgatcgagaccgacagcctggaggcg
gtcaccggcaaccgcccggtcagcgccctggtcgacccgcgccacctgcaccaggtgctc
accgtgctggtccacaacgccctgaattacgggcgcatgcccggcgaaccggcgcggatc
cggctgcgcgtgttccagctggaccagcgcgcgatgatcgacgtgctcgaccgcggtccg
ggcatcccggcggcggtggccgcgcagctgttccggccgttcttcaccacctccgagcat
ggcaccggcctgggcctgtacatcgcccgcgagctgtgccgggccaaccaggccaccctg
gaacatgtcgccgtgcccggtggcggcagctgcttccgcatctccatgcccggccccaac
accctgctgtcgtag

DBGET integrated database retrieval system