KEGG   Pseudoxanthomonas spadix: DSC_08470Help
Entry
DSC_08470         CDS       T01643                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00380  Tryptophan metabolism
psd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DSC_08470
Enzymes [BR:psd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DSC_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AER56344
UniProt: G7UV64
LinkDB All DBs
Position
complement(1657185..1658459)
Genome map
AA seq 424 aa AA seqDB search
MNHALSRTHAIALDAADPLRSFRNEFLLPRHKNNDQAYFCGNSLGLQPRGARKAVEQVLD
TWAHEAVEGHFRGQGQWLTYHEQVREPLARIVGALPGEVVAMNTLTANLHLMMVSFYRPT
AQRPAILMEAGAFPSDHYAVQSQIRFHGFNPATDLIEVAPDEAEGTVSMEAIEQAIAEHG
HRLALVLWPGIQYRTGQAFDIAQITRLAHAAGAMAGFDLAHAAGNIPLALHDADADFAVW
CNYKYLNAGPGAVAGAFVHQRHAQAELPRFAGWWGHEKQTRFLMAPQFRPTPGADGWQLS
NPPILAMAPLLASLELFDKAGGVPALRAKSEKLTSFLEELIEARLLDTLDIITPAEPERR
GCQLSLRVAGGRERGRGLFDYLAKVGVLGDWREPDVIRIAPVPLYNSFKDIYRFVEEVEM
WAGV
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacgcgctttcccgcacccacgccatcgccctggacgccgccgatccgctgcgc
agctttcgcaacgaattcctgctgcccaggcacaagaacaacgatcaggcgtacttctgt
ggcaactcgctgggcctgcagccgcgcggggcgcgcaaggccgtcgagcaggtcctggac
acatgggcgcacgaggcggtggagggccacttccgtggccaggggcagtggctgacctac
cacgagcaggtgcgcgagccgctggcgcgcatcgtcggcgcgctgcctggcgaagtggtg
gcgatgaacaccctgaccgccaacctgcacttgatgatggtcagtttctaccggcctacg
gcacaacgcccggcgatcctgatggaagccggcgcatttccctccgaccactacgcggtg
cagtcgcagatccgcttccatggcttcaacccggccaccgacctgatcgaggtggcaccg
gatgaagccgaaggcacggtctccatggaggcgatcgaacaggccatcgccgagcacggc
catcgcctggcgctggtgctgtggccgggcatccagtaccgcaccggccaggccttcgac
atcgcccagatcacacgcctggctcacgccgccggggcgatggccggcttcgacctggcc
cacgctgccggaaatatcccgctggcgctgcacgatgccgatgcggattttgcggtgtgg
tgcaactacaagtacctcaatgcaggcccgggcgcggtggcaggtgcgttcgttcaccag
cgccatgcgcaggccgagctgccgcgctttgccggctggtggggccacgagaaacaaacc
cgcttcctgatggcgccccagttcaggcccacgccgggcgccgacggctggcagctgagc
aacccgccgatcctggcgatggcgccgctgctggcctcgctggagctgttcgacaaggcc
ggcggcgtgccggcactgcgggccaagtcggaaaagctcaccagtttcctggaggagctg
atcgaggcgcgcctgctggacaccctggacatcatcaccccggccgaacccgaacgccgc
ggctgccagctgtcactgcgcgtggccggcgggcgcgagcgcggccgcgggctgttcgac
tacctggccaaggtcggcgtgctcggtgactggcgcgagccggacgtgatccgcatcgcg
ccggtgccgctgtacaacagcttcaaggacatctatcgcttcgtggaagaagtggagatg
tgggccggcgtctga

DBGET integrated database retrieval system