KEGG   Pseudoxanthomonas spadix: DSC_08755Help
Entry
DSC_08755         CDS       T01643                                 

Definition
(GenBank) ring hydroxylating dioxygenase, alpha subunit
  KO
K08689  biphenyl 2,3-dioxygenase subunit alpha [EC:1.14.12.18]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_08755
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.18  biphenyl 2,3-dioxygenase
     DSC_08755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ring_hydroxyl_A Rieske
Motif
Other DBs
NCBI-ProteinID: AER56401
UniProt: G7UVT2
LinkDB All DBs
Position
complement(1711383..1712726)
Genome map
AA seq 447 aa AA seqDB search
MKGIPEWTPETVRALVDQEKGLLDPRIYTDQGLYELELERVFARSWLLLGHESHIPKTGD
FMTTYMGEDPVVMVRQPDKSIKVFLNQCRHRGMRICRTDAGNAKAFTCSYHGWAYDVSGK
LVNVPFEKEAFGDKHDGDCGFDKAEWGPLQARVATYKGLVFANWDAQAPDLETYLGDARP
YMDIMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTMSHLSGILAGMPPEMD
LSHAQVPTKGNQFRAGWGGHGSGWFVDEPGMLMAVMGPKVTQYWTEGPAADLAEQRLEHT
GMPVRRMFGQHMSVFPTCSFLTAVNTIRTWHPRGPNEIEVWAFTLVDAEAPAEIKEEYRR
HNIRTFSAGGVFEQDDGENWVEVQKVMRGHKARSRPLNAQMGLGRSQTGHPEFPGKIGYV
YSEEAARGMYHHWSRMMSEPSWATLKP
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggaatccctgagtggacaccggaaacggtccgcgcactggtcgatcaggaaaaa
ggcctgctggacccgcgcatctacaccgaccagggtctatacgaactggagctggagcgg
gtctttgcccgctcctggctgttgctcgggcatgagagccatattcccaagactggggac
ttcatgacgacttacatgggtgaagatccggtggtcatggtgcgccagccagacaagagc
atcaaggtgttcctgaatcagtgccggcaccgcggcatgcgcatctgtcgcaccgacgcc
ggcaacgccaaggccttcacctgcagctaccacggctgggcctacgacgtctcgggcaag
ctggtgaacgtgcccttcgaaaaagaggccttcggcgacaagcacgacggcgactgcggc
tttgacaaggccgaatggggcccgctgcaggcacgcgtggccacttacaagggcctggtc
ttcgccaactgggatgcgcaggcgcctgacctggagacctacctcggtgacgcccgtccg
tacatggacatcatgctggatcgcacgccggccgggaccgtggcgatcggcggcatgcag
aagtgggtcattccgtgcaactggaagtttgccgccgagcagttctgcagtgacatgtac
cacgccggcaccatgtcccacctgtccggcatcctggcgggcatgccgccggaaatggac
ctgtcgcatgcacaggtgcccaccaagggcaaccagttccgggccggctggggcgggcac
ggctcgggctggttcgtcgacgagccgggcatgctcatggcggtgatggggcccaaggtc
acccagtactggaccgagggtccggctgccgacctggcagaacagcgcctggaacatacc
ggcatgccggttcgacgcatgttcggccagcacatgagcgtctttccgacctgttcgttc
ctcactgccgtcaacaccatccggacctggcacccgcgcggccccaatgaaatcgaggtg
tgggccttcaccctggtcgatgccgaggccccggccgagatcaaggaagaatatcgccgg
cacaacatccgcaccttctctgcaggcggcgtgttcgagcaggacgatggcgaaaactgg
gtcgaggtccagaaagtgatgcgcgggcacaaggccaggagccggccgctcaatgcccag
atgggtctgggccggtcgcagaccggccaccccgagttccccggcaagatcggctatgtc
tattccgaagaagcggcgcggggcatgtaccaccactggtcgcgcatgatgtccgagccc
agctgggccacgctcaagccctga

DBGET integrated database retrieval system