KEGG   Pseudoxanthomonas spadix: DSC_09115Help
Entry
DSC_09115         CDS       T01643                                 

Definition
(GenBank) benzyl alcohol dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00260  Glycine, serine and threonine metabolism
psd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DSC_09115
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     DSC_09115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C PrmA
Motif
Other DBs
NCBI-ProteinID: AER56473
UniProt: G7UWG6
LinkDB All DBs
Position
complement(1793330..1794415)
Genome map
AA seq 361 aa AA seqDB search
MISITFDLWASGAMLAIRKITAGHGGLSVDDVPAPKEARGSDVLVKVEAAGICGTDLLIY
KWGDFAKRMKLPTIIGHEISGVVEQVGSDVKGLRPGMRVSLESHVPCGVCYTCRRGWAHV
CPHTRYPGVDFDGGFAPFVMVPESVCWPVPPEISPLQAAMMEPFGLAVHASMEGSGVSGL
NVLVSGCGPIGLMNIAAARALGASKVIATDVHPLRLAAAARMGVDECVNAADDSVYETVR
SLLGERGVDVAIDYSGQASALKALIQSITHGGELRLMGVPSQEISLNLEEWLFKGLVVRG
LHGRGLFETWERSTTLLANGRVDLSSLVSHRVALSDAQDAFEMALNGKSLKILFEPNGAC
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
ttgatatctataacatttgacctttgggcgagtggcgcgatgttggcgataagaaaaatt
accgccgggcatgggggtctgtctgtagacgatgtgcctgcgccaaaggaggcccgcggc
agcgacgtattggtgaaggtcgaggcagctggaatctgcggtactgacctgctgatctac
aagtggggcgactttgcgaagcggatgaaactgccgaccatcatcggtcacgagatcagt
ggggtggttgaacaggtcggttcggacgtcaagggcctgcgacccggaatgcgagtcagt
ctggagagccatgttccttgtggagtctgctacacctgtcggcgtggttgggcccatgtg
tgtcctcatacgcgctatccaggcgtcgactttgacggggggtttgccccgttcgtcatg
gttccggaaagtgtgtgttggccggtgccgcctgaaatctctccactgcaggcggccatg
atggagccttttggactggcggtacacgccagcatggagggttccggggtctcgggattg
aatgtccttgtctctggttgcgggccgatcggactgatgaacattgcagctgcccgggca
ttgggcgcaagcaaggtgattgctacggatgtccatccgctccgcctggccgcggcagcc
aggatgggggtcgacgaatgtgtcaatgcagctgatgacagtgtttacgagacggtgcgc
tcattgctcggtgagagaggggtcgatgtcgcgattgactactctgggcaggcgtcggca
ctgaaagcgcttattcaatccatcactcatgggggtgagttgcggctgatgggcgttccc
tcgcaggagatttcactcaacctggaagagtggctcttcaagggacttgtggtccgtggg
cttcatggaagaggccttttcgaaacctgggaacgttcaacaactctcctcgccaacggg
cgtgtcgacttgtcttcgcttgtttcgcatcgcgtggccctttccgatgcacaggatgcg
tttgaaatggccttgaatggaaagtcgttaaaaatcctgtttgagcccaatggcgcatgt
gcctga

DBGET integrated database retrieval system