KEGG   Pseudoxanthomonas spadix: DSC_09345Help
Entry
DSC_09345         CDS       T01643                                 

Definition
(GenBank) biphenyl 2,3-dioxygenase ferredoxin reductase subunit (BphA4)
  KO
K18088  biphenyl 2,3-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_09345
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     DSC_09345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C NAD_binding_8 Lycopene_cycl Pyr_redox_3 DAO GIDA FAD_binding_3 AlaDh_PNT_C FAD_binding_2 3HCDH_N 2-Hacid_dh_C XdhC_C
Motif
Other DBs
NCBI-ProteinID: AER56517
UniProt: G7UWL0
LinkDB All DBs
Position
1835450..1836676
Genome map
AA seq 408 aa AA seqDB search
MIEAISIIGAGLAGATAARALRAQGYTGRLHLVGDEPRHAYDRTTLSKAVLKGEQPEPPA
ILDASWYASADVDLQLGRRVSGLDVANREIQFESGASLAYDRLLLATGARPRRVAIPGCD
LAGIHTLRDLADSEALRRALRPGQSLVIVGGGLIGCEVATTARKVGVDVTILEAGDELLL
RVLGHRTGSWCRTELERMGVRVERNAQASRFEGEGQVRTVVCADGRQVAADVVLVSIGAE
PADELARAAGIACARGVLVDATGASSCPEVFAAGDVAAWPLRQGGQRSLETYLNSQMEAE
VAASAMLGAPVPTLQVPSSWTEIAGHRIQMIGDAEGPGEIILRGDAQAGQPLVLFRLLDG
CVEAATAINATREFSVATRLVGARIPVSAEQLQDVGSNLRDLLKAKSS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagccatctccatcatcggcgccggcctggccggggcgacggctgcgcgcgcg
ttgcgtgcccaggggtataccggacgccttcacctggtcggggacgaaccgcggcacgct
tatgaccgaaccacactgtccaaggcggtgttgaagggcgagcagcccgagccgcctgca
atcctggacgcctcctggtacgcatcggccgacgtggacctgcaactcgggcgacgggtg
agtggcctggatgtggccaaccgcgagattcagttcgaatccggtgcctcgctggcctac
gatcggctgctgctggcgaccggcgcgcgcccgcgacgcgtggcgattccgggttgcgac
ctggctggcatccacaccctgcgagacctcgccgacagcgaggcgctgcgacgggcgctg
cgccctggccagtcgctggtcatcgtcggcggaggcctgatcggctgcgaggtggcgacc
accgcgcgcaaggtcggcgtcgatgtcacgatcctggaagcaggagatgagttgctgctg
cgtgtactgggtcatcgaaccgggtcctggtgccgaaccgaactggaacgcatgggtgtc
cgggtggagcgcaatgcacaggcctcgcgcttcgaaggtgagggtcaggtgcgcaccgtc
gtctgcgccgatgggcgccaggtggcagccgacgtggtgctggtcagcattggcgccgag
ccggcggacgagctggcgcgggcggcgggcatcgcctgcgcacgcggcgtgctggtcgac
gccaccggcgcgagctcctgcccggaggtgttcgccgccggtgacgtcgccgcatggccg
ctgcgtcaaggtggccagcgctcgctggagacctacctgaatagccagatggaggccgaa
gtcgcggccagcgccatgttgggcgcgcccgtgccgacgctgcaggtgccgagctcctgg
acggagattgcgggccaccgcatccagatgattggcgatgccgaggggcccggggaaatc
atcctgcgcggcgatgcgcaggccggccagccactggtgttgttcaggttgcttgacggc
tgtgttgaagcggcgacggcgatcaatgccaccagggaattttctgtggcgacccgactg
gtcggcgcccggattcctgtctcagccgagcagttgcaggatgtcggctcaaatttgcgg
gatttgctcaaggccaaatcaagttga

DBGET integrated database retrieval system