KEGG   Pseudoxanthomonas spadix: DSC_09385
Entry
DSC_09385         CDS       T01643                                 

Definition
(GenBank) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BphD)
  KO
K10222  2,6-dioxo-6-phenylhexa-3-enoate hydrolase [EC:3.7.1.8]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00543  Biphenyl degradation, biphenyl => 2-oxopent-4-enoate + benzoate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_09385
Enzymes [BR:psd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.8  2,6-dioxo-6-phenylhexa-3-enoate hydrolase
     DSC_09385
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Peptidase_S9 DUF915
Other DBs
NCBI-ProteinID: AER56525
UniProt: G7UWL8
LinkDB
Position
1843962..1844786
AA seq 274 aa
MKINEAGFSDFNIHYNDAGQGETVIMLHGGGAGAGGWSNYYRNIGPFVEAGYRVILKDSP
GFNKSDAVVVEEQRGLANARAVKGLMDALGIDRAHLVGNSMGGATALNFALEYPERIGKM
ILMGPGGLGPSMFAPMPMEGIKLLFKLYAEPSYETLKQMIQVFLYDQSLITEELLQGRWE
AIQRHPEHLKNFLISAQKAPLSSWDVSARLGEIKAKTFVTWGRDDRFVPLDHGLKLLWTL
GDARLHVFSKCGHWAQWEHADEFNRLVIDFLKHD
NT seq 825 nt   +upstreamnt  +downstreamnt
gtgaaaatcaatgaggcaggattttcggatttcaatatccattacaacgatgccggtcag
ggtgaaaccgtcatcatgctgcacggcgggggcgccggcgccggtggctggagcaattat
taccgcaacattggccccttcgtcgaagctggctaccgggtgatcctgaaggattcgccc
ggcttcaacaagtccgacgcggtggtggtggaggagcagcggggcttggccaacgcccgt
gcagtcaaggggctgatggacgcgctgggtatcgaccgggcgcacttggtcggcaactcg
atggggggcgccacagccctgaacttcgctctcgaataccccgagcgtatcggcaaaatg
atcctcatgggacccggcggactgggtccgagcatgttcgcgccgatgccgatggaaggc
atcaagctgctgttcaagctgtacgccgagccatcctatgaaaccctgaaacagatgatc
caggtgtttttgtatgaccagtcactcatcaccgaggagttgctgcagggtcgctgggaa
gcgattcagcgtcacccggagcacctgaagaacttcctcatcagcgcgcaaaaggcgccg
ctctcgagctgggacgtgtctgccaggctcggagaaatcaaggccaagacattcgtgact
tggggacgcgatgaccgcttcgtccccctcgaccacggcctgaagctgctgtggaccctt
ggcgacgcacgtttgcatgtgttctccaagtgtggccactgggcgcaatgggagcacgcc
gacgagttcaaccgcctggtgattgatttcctgaagcatgattaa

DBGET integrated database retrieval system