KEGG   Pseudoxanthomonas spadix: DSC_11535Help
Entry
DSC_11535         CDS       T01643                                 

Definition
(GenBank) adenylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00230  Purine metabolism
psd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DSC_11535
Enzymes [BR:psd01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     DSC_11535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CYTH DUF3565
Motif
Other DBs
NCBI-ProteinID: AER56951
UniProt: G7UQE8
LinkDB All DBs
Position
complement(2306015..2306533)
Genome map
AA seq 172 aa AA seqDB search
MGIEIERKFLLANDGWRAAVHRAIPMAQGYLNDLAVVESGAQKASVRVRIEGQSATLNFK
SRQAGPTRQEFEYPIPVADARALLELCVGGLVEKTRHLVQVGAHLWEIDEFTGDNAGLVV
AEIELGHADEAFERPPWLGRQVTDRLRYYNLALAGRPYSQWSEDERNAADVE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggggatcgaaatcgagcgcaagttcctgctggccaacgatggctggcgcgccgcggtg
catcgggccatcccgatggcccagggctatctcaacgacctggccgtggtggaaagcggc
gcgcagaaggcctcggtgcgggtgcgcatcgaagggcagagcgccacgctgaacttcaag
tcgcgccaggccggtcccacccgccaggagttcgaatatccgatcccggtggccgatgcc
cgggccctgctcgagctgtgcgtgggcggcctggtcgaaaagacccgccacctggtgcag
gtcggtgcccacctgtgggaaatcgacgagttcaccggcgacaacgctggcctggtggtg
gccgagatcgaactgggccacgccgacgaggccttcgaacgtccgccctggctgggccgg
caggtcaccgatcgcctgcgctattacaatctggccctggccgggcggccgtattcgcaa
tggagcgaagacgagcgcaacgcggccgacgtcgaataa

DBGET integrated database retrieval system