KEGG   Pseudoxanthomonas spadix: DSC_13085Help
Entry
DSC_13085         CDS       T01643                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psd  Pseudoxanthomonas spadix
Brite
KEGG Orthology (KO) [BR:psd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DSC_13085
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DSC_13085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 NAD_binding_7 Glutaredoxin NAD_binding_8 DAO Thi4 AlaDh_PNT_C K_oxygenase FMO-like Thioredoxin_4
Motif
Other DBs
NCBI-ProteinID: AER57261
UniProt: G7USL0
LinkDB All DBs
Position
2639411..2641006
Genome map
AA seq 531 aa AA seqDB search
MLDDTLKTQLKTYLQRVTRPVEIVASVDDSATSREMLELLEDILQLSDQVSLVQQRNADP
HTPSFALNSPGQDIHLRFAGLPMGHEFTSLVLALLQVGGYPSKAAPDTIEQIQGLDGDYR
FETYFSQSCQNCPDVVQALNLMAVLNPRIQHVAIDGAVFPEEVEQRQVMSVPTVYLNGEV
FGQGRMTLEEIVGRLDAGAARREAKKLSAKDPFEVLVVGGGPAGAAAAIYAARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKMAAALEAHVRQYEVDIMNLQRAEKLVPAGDDG
LISIELANGATLKGKTVILSTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGVVRHVTLIEFDHKLRADEVLQRKLRSLPNVTILLSALSTQVHGDG
SKVTGLSYTDRTNDTGHTIELEGIFVQIGLLPNTEWLKGTVELSPRGEIVIDERGQTSVP
GVFAAGDATTVPYKQIVIAMGEGAKAALSAFDHLIRHSAPAQAPVAEAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgacaccctcaagacccagctcaagacctatctgcagcgcgtgacccgacca
gtggaaatcgtggcctcggtggacgattcggccacctccagggaaatgctggaactgctg
gaggacatcttgcagctgtccgaccaggtctcactggtccagcagcgcaatgccgatccg
cacacgccttcgttcgcactgaattcgccgggccaggacatccacctgcgctttgccggc
ctgccgatgggccacgagttcacctcgctggtgctggccctgctgcaggtcggcggttat
ccgtccaaggccgcgccggacacgatcgagcagatccagggcctggacggcgactaccgg
ttcgagacctatttctcgcagagctgccagaactgcccggacgtggtccaggccctgaac
ctgatggcggtcctgaatccacgcatccagcacgtggccatcgacggggcggtgttcccg
gaagaggtcgagcagcgccaggtgatgtcggtgcccaccgtctacctcaacggcgaggtc
ttcggtcagggccgcatgaccctggaagagatcgtcgggcggctggacgctggtgcggcc
aggcgcgaggccaagaagctctcggccaaggatcctttcgaggtgctggtggtcggcggc
ggcccggctggcgcggccgcggcgatctacgccgcgcgcaagggcatccgcaccggggtg
gtggccgagcgcttcggcggccaggtcctggacaccatggcgatcgagaacttcatctcg
gtccaggagaccgaagggccgaagatggccgcggcactggaagcccacgtgcgccagtac
gaggtggacatcatgaacctgcagcgcgccgaaaagctggtgccggccggtgacgacggc
ctgatctcgatcgagctggccaacggcgccacgctcaagggcaagaccgtgatcctgtcc
actggcgcgcgctggcggcagatgaacgtgcccggcgaggaccagtaccggaacaagggc
gtggcctactgcccgcattgcgacggtccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaattcgggcgtggaagcggccatcgatcttgccggcgtggtcaggcacgtc
accctgatcgagttcgatcacaagctgcgcgccgacgaggtcctgcaacgcaagctgcgc
agcctgcccaacgtgaccatcctcctgtcggcgttgagcacgcaggtgcatggcgacggc
agcaaggtcaccggcctgtcctataccgaccgcaccaacgacaccggccacaccatcgag
ctggaaggcatcttcgtgcagatcggcctgctgcccaacaccgaatggctcaagggcacg
gttgaactgtccccacgtggggagatcgtgatcgacgagcgcggtcagacttcggtcccg
ggtgtgttcgctgccggcgatgccaccacggtgccctacaagcagatcgtgatcgccatg
ggcgaaggcgccaaggctgcgctgagcgccttcgaccacctgatccgccacagtgcgccg
gcccaggcgccggtggccgaggcgcaagcggcctga

DBGET integrated database retrieval system