KEGG   Pseudoxanthomonas spadix: DSC_13530Help
Entry
DSC_13530         CDS       T01643                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00500  Starch and sucrose metabolism
psd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DSC_13530
Enzymes [BR:psd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     DSC_13530
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     DSC_13530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap
Motif
Other DBs
NCBI-ProteinID: AER57350
UniProt: G7UTA4
LinkDB All DBs
Position
complement(2744759..2748109)
Genome map
AA seq 1116 aa AA seqDB search
MNAVRSLAPEAETSALVADALWYKDAIIYQVHVKSFFDSNDDGIGDFPGLISKLDYIAEL
GVDTVWLLPFYPSPRRDDGYDIAEYMAVHPDYGGIADFQRFVEQAHARGIRVVTELVINH
TSDQHPWFQRARNAPAGSPERAFYVWSDTDQEYAGTRIIFCDTEKSNWTWDPVAGQYFWH
RFYSHQPDLNFDNPAVLEAVLEVMRFWLDMGVDGLRLDAVPYLIERPGTSNENLPETHAI
LRRIRATVDAEYPDRMLLAEANMWPEDTQQYFGANGDECHMAFHFPLMPRMYMAIAREDR
FPITDIMRQTPEIPESCQWAIFLRNHDELTLEMVTDSERDYLWQTYASDRRARINLGIRR
RLAPLLERDRRRIELMTSLLLTMPGTPVLYYGDEIGMGDNIHLGDRDGVRTPMQWSIDRN
GGFSRADPAALVLPPIMDPLYGFQAVNVEAQMRDQHSLLTWTRRVLSVRKRYHAFGRGSL
RFLYPGNRRMLAYLRCYQDEIVLCVASLSHTLQAVELDLSEFEGRVPVDLVGGGSFPPIG
RLTYLLTVPAFGFYAFQLVSEGAMPDWHVPSPVPLPDYRTLVLRSGVDESSALLPHLATL
EREILPAWLAARRWFSAKDRAVKRVRVWRRTPLPGDEPITLLELDVELEDGHHECYMLPV
GIVWEREQPSTLAEQLALARVRQGREVGYLTDAFALKAMVRGIIAALRQNAVLEVQGEQD
AASQGQIRFEATAALAAVEIADDPEVRWLSAEQSNSSLVVADKAVFKLLRRAVSGINPEI
EIGRRLTEAGYANAAPLLGSVSHVDAQGNVTTIALLQGFVRNQGDAWRWTLDHLARSFDE
FATAPSDQARAESVDGYGTFAAVVGKRLAELHEVLSGPTDDPDFAPQQVEPATARAVAQA
VARQVEETWATLSARLQSSEDAAERTALEALLAGRAQLDALLAHAPEALTGSLLTRVHGD
FHLGQILVAFDDVVLIDFEGEPAKPLAERRAKASPLRDVAGFLRSLDYASVVAARGEEGT
AARSGVGVDAHLEEFLARFRRRATAAFLDAYRKVLQASAHPWIAPAALDAAILLFLVEKA
CYEVRYEAANRPTWLLVPVQGLLRLLQGSDTEAGDG
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcggttcgctcccttgcgcccgaggcggagacttccgcgctcgtggccgatgcg
ctctggtacaaggacgcgatcatctaccaggtgcacgtcaagtcgttcttcgactccaac
gacgatggcatcggcgattttcccgggctgatctccaagctggactacatcgccgaattg
ggcgtggacacggtctggctgctgccgttctatcccagcccgcgtcgcgatgacggctac
gacattgccgagtacatggcggtgcaccccgactacggcggcatcgccgacttccagcgc
ttcgtcgagcaggcgcacgcgcgcgggatccgcgtggtcaccgaactggtgatcaaccac
acctccgaccagcatccctggttccagcgcgcgcgcaatgcgccggcgggatcgccggag
cgcgccttctacgtgtggtcggacaccgaccaggaatacgccggcacccggatcatcttc
tgcgataccgagaagtccaactggacctgggatccggtcgccgggcagtacttctggcac
cgtttctattcgcaccagccggacctgaacttcgacaacccggcagtgctggaagcagtg
ctggaggtgatgcgcttctggctggacatgggcgtggacgggctgcgcctggacgcggtg
ccgtacctgatcgagcgccccggcacctccaacgagaacctgcctgaaacccacgcgatc
ctgcgtcggatccgtgccaccgtggacgccgaatatcccgaccgcatgctgctggccgag
gccaacatgtggccggaggacacccagcagtatttcggcgccaatggtgacgaatgccac
atggcgttccacttcccgctgatgccgcgcatgtacatggccatcgcgcgcgaggaccgc
ttcccgatcaccgacatcatgcgccagacgccggaaatcccggagtcctgccagtgggcg
atcttcctgcgcaaccacgacgagctgaccctggagatggtcaccgactccgagcgcgac
tacctgtggcagacctacgcctcggatcgtcgcgcccgcatcaacctgggcatccgccgg
cgcctggccccgctgctggagcgtgaccgccgccgcatcgaactgatgacctcgctgctg
ctgaccatgcccggcaccccggtgctgtactacggcgatgagatcgggatgggcgacaac
atccacctgggcgaccgcgacggcgtgcgcacgccgatgcagtggtcgatcgaccgcaac
ggtggcttctcgcgcgccgacccggcggcgctggtgctgccgccgatcatggatccgctg
tacggcttccaggcggtcaatgtcgaggcgcagatgcgcgaccagcattcgctgctgacc
tggacccggcgggtgctcagcgtgcgcaagcgctaccacgccttcggccgcggttcgctg
cgattcctctacccgggcaaccgccgcatgctggcctatctgcgctgttaccaggacgag
atcgtgctgtgcgtggccagcctctcgcacacgctgcaggcggtcgagctggacctgtcc
gaattcgagggtcgggtgccggtggacctcgtcggtggtggcagtttcccgccgatcggg
cggctcacctatctgctcaccgtgcccgcatttggcttctacgcatttcaactggtcagc
gagggcgccatgcctgactggcacgtgcccagcccggtgccgctgccggactaccgcacc
ctggtgctgcgcagcggcgtggacgaaagcagcgcgctgctgccgcacctggcgaccctg
gaacgggagatcctgccggcctggctggctgcgcgacgctggttctcggccaaggaccgg
gcggtcaagcgggtgcgggtgtggcgacgcacgccgttgccaggcgatgagccgatcacc
ctgctggagctggatgtggagctggaggacggccatcacgagtgctacatgctgccggtg
ggcatcgtctgggagcgcgagcagcccagcacgctggccgagcagctggcgctggcgcgg
gtgcggcagggccgcgaggtcggctacctgaccgatgcattcgcgctcaaggcaatggtg
cgcgggatcatcgcggcgctgcggcagaacgccgtgctggaggtccagggcgagcaggat
gccgcgtcgcaggggcagatccgcttcgaggcgaccgcggcgctggcggcggtggagatc
gccgacgatccggaggtgcgctggctgtcggccgagcagagcaacagttcgctggtggtc
gccgacaaggccgtgttcaagctgctgcggcgcgcggtctccgggatcaatccggaaatc
gagatcggccggcgcctgaccgaggccggctacgccaatgccgcaccgctgctgggcagc
gtcagccacgtcgatgcccaaggcaacgtcaccacgatcgcgctgctgcaaggcttcgtg
cgcaaccagggcgatgcctggcgctggaccctggaccacctggcgcgcagcttcgatgag
ttcgccaccgccccaagcgaccaggcccgcgccgagagcgtggacggttatggcaccttc
gccgctgtggtcggcaagcgcctggccgagctgcacgaggtgctgtcgggtccaaccgac
gatcccgacttcgcgccacagcaggtcgagccggccaccgccagggcggtggcccaggcg
gtggcgcggcaggtggaggagacgtgggcgacgctgtcggcgcggctgcaaagcagcgag
gacgccgccgagcgcactgcgctggaggccctgctggccgggcgcgcacagctggatgcg
ctgttggcgcatgcgcccgaagcgctcaccggctcgctgctgacccgcgtgcacggcgac
ttccacctgggccagatcctggtggcgttcgatgacgtggtgctgatcgacttcgagggc
gaaccggccaagccgctggccgaacgtcgcgccaaggccagtccgctgcgcgacgtggcc
ggtttcctgcgctcgctcgactacgccagcgtggtggccgcgcgcggcgaggaaggcacc
gccgcgcgctcgggcgtgggcgtggatgcgcacctggaggagttcctggcgcggttccgt
cgccgtgccaccgccgcgttcctcgacgcctaccgcaaggtgctccaggccagcgcccat
ccgtggatcgcgccggcggcgctggacgcggcgatcctgctgttcctggtcgagaaggcc
tgctacgaggtgcgctacgaagcggccaaccggccgacctggttgctggtgcccgtccag
ggcctgctgcgcctcttgcagggttcggacaccgaagcaggggatggatga

DBGET integrated database retrieval system