KEGG   Pseudoxanthomonas spadix: DSC_14565Help
Entry
DSC_14565         CDS       T01643                                 

Definition
(GenBank) meta cleavage compound hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00621  Dioxin degradation
psd01100  Metabolic pathways
psd01120  Microbial metabolism in diverse environments
psd01220  Degradation of aromatic compounds
Module
psd_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    DSC_14565
Enzymes [BR:psd01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     DSC_14565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 Peptidase_S9 Esterase Abhydrolase_5 DUF3141 FSH1 Abhydrolase_4
Motif
Other DBs
NCBI-ProteinID: AER57557
UniProt: G7UUT4
LinkDB All DBs
Position
complement(2973558..2974382)
Genome map
AA seq 274 aa AA seqDB search
MINLDVHGHNIMVDGVSTFFIDVGAGKPIVLIHGGGAGADSWGNWKDVIPALGDGFRVIA
VDMLGFGHTGKPNGDFVYSQQARIRHMAAFLKALDLDAPLVVGNSMGGATALGIAVEHPE
LIGKLILMGSAGLNTQVHEDLKPVIHYDFTRDGMVRLVRALTTDAFVIDDALIDYRFSLA
TDPDTRRAYAAAMAWIREQNGLFYPEAYIRQNRVPTLVVNGKNDKVVPVSNAYKFLDLIE
QSSGYIMPYCGHWAMIEHPVAFARITRDFALTAA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgattaatctagacgtacatggccacaacatcatggtggatggcgtgtcgacttttttc
atcgacgtcggtgctggcaagcccatcgtgctgatccacggtggcggcgctggcgcggat
agctggggcaactggaaggacgtcattccggcactgggtgacggtttcagggtgatcgcc
gttgacatgcttggcttcggtcacacgggcaagcccaatggcgatttcgtctactctcaa
caggcccgcatccggcacatggccgcgttcctgaaagccctggacctggacgcgccgctt
gtcgtcggcaactccatgggcggcgccaccgccttgggtatcgcggtcgagcatccggaa
ttgattggaaagctcatactcatgggcagtgccgggctcaacacgcaggtgcacgaggac
ctcaagcccgtcatccattacgatttcacgcgcgatggaatggtccgcctggtccgcgcc
ctgacgacagacgcgttcgtcattgatgatgcgctcatcgactatcgcttctccctggca
accgacccagatacgcgccgggcttacgcggcagccatggcatggatccgtgaacagaat
ggcctcttttaccccgaggcctatattcgacagaaccgtgtaccaactttggtcgtcaac
ggtaagaacgataaagttgttccagtttcaaatgcctacaaattcctggatttaatcgag
caatcatccggctatatcatgccctattgcggtcactgggcgatgatcgagcatcccgtt
gcgtttgcgcgcatcacccgtgacttcgcattgacggccgcatga

DBGET integrated database retrieval system