KEGG   Pseudoxanthomonas spadix: DSC_15135Help
Entry
DSC_15135         CDS       T01643                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd03030  DNA replication
psd03410  Base excision repair
psd03420  Nucleotide excision repair
psd03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psd00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    DSC_15135
   03410 Base excision repair
    DSC_15135
   03420 Nucleotide excision repair
    DSC_15135
   03430 Mismatch repair
    DSC_15135
Enzymes [BR:psd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     DSC_15135
    6.5.1.6  DNA ligase (ATP or NAD+)
     DSC_15135
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     DSC_15135
DNA replication proteins [BR:psd03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    DSC_15135
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     DSC_15135
DNA repair and recombination proteins [BR:psd03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DSC_15135
   NER (nucleotide excision repair)
    Other NER factors
     DSC_15135
   MMR (mismatch exicision repair)
    Other MMR factors
     DSC_15135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AER57671
UniProt: G7UW13
LinkDB All DBs
Position
complement(3091430..3092299)
Genome map
AA seq 289 aa AA seqDB search
MRVMLLSLLLSLLLNCLLLGVPAHAEPPRLMLATGYHGHLALADYLVSEKLDGVRGRWDG
QALWTRGGARIDAPAWFTRGWPTQPLDGELWLGRGRFDAASALVRAGNADDPAWHDLHFM
LFDLPADAGPFEARVARMQALVKASGNAQLRLVEQRRIDNVAALDAQFARVVAAGGEGLM
LHRRDAHYLVGRSDALLKYKPYDDAEARVVAHLGGKGKYAGLLGALLVQLPDGRSFRIGS
GFTDAQRAAPPPLGAWVTYRYNGLTSKGLPRFARFLHVRDEPPPPDPQR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcatgttgctgtcgctgttgctgtcgctgttgctgaactgtctgctgctgggc
gtgccggcgcatgccgagccgccgcgcctgatgctggccaccgggtaccacggccacttg
gcgctcgccgattacctggtcagcgaaaagctcgatggcgtgcgcggccgttgggatggc
caggcgctgtggacgcgtgggggcgcacggatcgacgcgccggcctggttcacccgcggc
tggccgacgcagccgctggatggcgagctgtggctcgggcgtggccggttcgatgcggcc
agcgcgctggtccgcgcaggcaacgcggacgatccggcatggcatgacctgcacttcatg
ctgttcgacctgccggccgatgccgggccgttcgaagcgcgcgtggcgcggatgcaggcg
ctggtcaaggccagcggcaatgcgcagctgcgcttggtggagcagcgccggatcgacaat
gtcgccgcactggatgcgcagttcgcccgggtcgtggccgctggtggcgaaggcctgatg
cttcaccggcgtgatgcgcattacttggtcgggcgcagcgatgcgctgctcaagtacaag
ccctacgacgatgccgaggcgcgggtggtcgcccacctcggcggcaagggcaagtatgca
ggcctgcttggcgcgctgctggtgcagctgccggatgggcgaagcttccgtatcggcagc
ggcttcaccgatgcccagcgcgccgcgccgccgccgctgggcgcctgggtgacctatcgc
tacaacgggctgaccagcaagggcctgccgcgctttgcccgcttcctgcatgtgcgcgac
gaaccaccgccacccgatccgcagcgctga

DBGET integrated database retrieval system