KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0174Help
Entry
NH8B_0174         CDS       T01619                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00473  D-Alanine metabolism
pse00550  Peptidoglycan biosynthesis
pse01100  Metabolic pathways
pse01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pse00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NH8B_0174
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NH8B_0174
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NH8B_0174
Enzymes [BR:pse01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NH8B_0174
Peptidoglycan biosynthesis and degradation proteins [BR:pse01011]
 Precursor biosynthesis
  Amino acid ligase
   NH8B_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST RimK ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: BAK75023
UniProt: G2IV57
LinkDB All DBs
Position
197576..198487
Genome map
AA seq 303 aa AA seqDB search
MKQYGKVAVMMGGTSAEREVSLMSGGGVLKALQSQGVDAHAFDPAEKPLAALKDEGFERV
FIALHGPFGEDGTLQGALETMGMPYTGCGVMASAIGMDKWRTKLLWQGAGLPIPAFVLLA
DDSDFAVVEAQLGLPLFVKPATEGSSIGVTKVKHPGELRAAYEEARRYDKLVIAEAFVGG
GEYTCAIIGDKALPTIKIEPATEFYDYQAKYFRDDTVYRCPSGLSAEVEQRARELALTAF
EVLGGRGWGRVDFLMDEAGGIYLLEVNTSPGMTSHSLVPMAARVEGLSYEELCLAILDMA
HVG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagtacggaaaagtggcagtgatgatggggggcacctcggccgagcgcgaggtg
tcgctgatgagcggcggcggggtgctcaaggcgctgcagagccagggcgtggacgcgcac
gccttcgacccggccgagaagccgctcgccgcgctcaaggacgaggggttcgagcgcgtg
ttcatcgcgctgcatggcccgtttggcgaggatggcacgctgcagggcgcgctcgagacc
atgggcatgccgtacaccggctgtggcgtgatggcgtcggccatcggcatggacaagtgg
cgcaccaagctgctgtggcagggcgccgggctgccgattccggccttcgtgctgctcgcc
gacgacagcgatttcgccgtggtggaagcccagctcggcctgccgctgttcgtcaagccg
gccaccgagggttccagcatcggcgtcaccaaggtgaagcatccgggcgaattgcgtgcc
gcctacgaagaggcgcgccgctacgacaagctggtgatcgccgaggccttcgtcggcggc
ggcgagtacacctgcgccatcatcggcgacaaggcgctgccgaccatcaagatcgaaccg
gctaccgagttctacgactaccaggccaagtatttccgcgacgacacggtgtaccgctgc
ccgtccggcctgagcgcggaagtggaacaacgcgcgcgcgaactggcgctgaccgcgttc
gaggtgctgggcgggcgcggctggggccgggtggatttcctgatggacgaggcgggcggc
atctacctgctcgaggtgaacacctcgcccggcatgaccagccacagtctggtgccgatg
gcggcgcgggtggagggcttgagttacgaggagctgtgtctggcgattctggacatggcc
catgtgggataa

DBGET integrated database retrieval system