KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0400Help
Entry
NH8B_0400         CDS       T01619                                 

Gene name
antA
Definition
(GenBank) anthranilate 1,2-dioxygenase, large subunit
  KO
K05599  anthranilate 1,2-dioxygenase (deaminating, decarboxylating) large subunit [EC:1.14.12.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00627  Aminobenzoate degradation
pse01100  Metabolic pathways
pse01120  Microbial metabolism in diverse environments
Module
pse_M00637  Anthranilate degradation, anthranilate => catechol
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    NH8B_0400 (antA)
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.1  anthranilate 1,2-dioxygenase (deaminating, decarboxylating)
     NH8B_0400 (antA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske Ring_hydroxyl_A
Motif
Other DBs
NCBI-ProteinID: BAK75241
UniProt: G2IW86
LinkDB All DBs
Position
complement(417852..419240)
Genome map
AA seq 462 aa AA seqDB search
MSTAKTPSQWQEFIGGCLDFRPTEGVYRMAREMFTEPELFELEMEFIFEKNWIYACHESE
IPNPHDFITLRAGRMPMIVTRDGNGGLNAMINACQHRGATLTRLSKGNQSTFTCPFHAWC
YKNDGRLLKVKAPGEYCEDFDKSARGLKKARIASYKGFVFISLDANGRDTLEDYLGDARV
FFDMMVAQSPTGELEVLPGKSTYTFDGNWKLQNENGLDGYHVSTVHYNYVATVQHRQGAN
AQKGEAGSGTLDYSKLGAGDAETDDGWFSFRNGHSVLFSDMPNPAVRPGYASVMPRLVEE
HGQAKAEWMMHRLRNLNIYPSLFFMDQISSQLRIVRPVAWNKTEIISQCIGVKGESDQDR
ENRIRQFEDFFNVSGMGTPDDLVEFREQQRGFQARLEHWNDISRGHHKWLQGATPNSELL
GIQPVLTGTELTHEGLYVNQHGAWREFLLKGLQQKCNDSKEI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcaaaaaccccatcgcaatggcaagaattcatcggcggctgtctggacttc
cgacccacggaaggcgtgtaccggatggcgcgcgagatgtttaccgaaccggaactgttc
gagctggagatggaattcatcttcgagaagaactggatctacgcttgccacgaaagcgaa
atccccaacccgcacgacttcatcaccctgcgcgccggccgcatgccgatgatcgtgaca
cgcgacggcaacggcggactgaacgccatgatcaacgcctgtcagcaccgcggcgccacg
ctgacgcgcctgagcaagggtaatcaatcgaccttcacctgcccgttccacgcctggtgc
tacaagaacgacggccgcctgctgaaggtgaaggcgccgggcgaatattgcgaggacttc
gacaagtccgcgcgcggcctgaaaaaggcgcgcatcgccagctacaagggcttcgtcttc
atcagtctggacgccaacggccgcgacacgctggaagactacttgggcgatgcgcgcgtc
ttcttcgacatgatggtggcgcagtcccccaccggcgaactggaagtgctgccgggcaaa
tccacctacaccttcgacggcaactggaagctgcagaacgagaacggcctggacggctac
cacgtcagcaccgtgcactacaactacgtggccacggtacaacaccgccagggagccaac
gcgcaaaagggcgaggccggcagcggcacgctcgactacagcaagctcggcgccggcgat
gccgaaaccgacgacggctggttctcgttccgcaacggccacagcgtgctgttcagcgac
atgcccaacccggcggtgcgccccggctacgccagcgtgatgccgcgcctggtggaggaa
cacggccaggccaaggcggagtggatgatgcaccgcctgcgcaacctcaacatctacccc
agcctgttcttcatggaccagatcagctcgcagctgcgcatcgtgcgcccggtggcctgg
aacaagaccgagatcatcagccagtgcatcggcgtgaagggcgaatcggaccaggaccgc
gaaaaccgcatccgccagttcgaggatttcttcaacgtctccggcatgggcacgccggac
gacctggtggaattccgcgaacagcaacgcggcttccaggcgcgcctggaacactggaac
gacatctcgcgcggccaccacaagtggctgcaaggcgccacgccaaacagcgagctattg
ggtatccagccggtgctgaccggcaccgaactgacccacgaaggcctgtacgtcaaccag
cacggcgcctggcgcgagttcctgctcaagggcctgcagcagaagtgcaacgacagcaag
gagatttga

DBGET integrated database retrieval system