KEGG   Pseudogulbenkiania sp. NH8B: NH8B_0608Help
Entry
NH8B_0608         CDS       T01619                                 

Gene name
pstB
Definition
(GenBank) phosphate ABC transporter, ATP-binding protein PstB
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pse00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NH8B_0608 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pse02000]
    NH8B_0608 (pstB)
Enzymes [BR:pse01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     NH8B_0608 (pstB)
Transporters [BR:pse02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    NH8B_0608 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_23 AAA_15 AAA_29 RsgA_GTPase AAA_16 Rad17 AAA_30 PRK AAA_28 HAD_2 AAA_33 SbcCD_C AAA_5 AAA_24 AAA RNA_helicase ATPase_2 Mg_chelatase
Motif
Other DBs
NCBI-ProteinID: BAK75443
UniProt: G2IX94
LinkDB All DBs
Position
complement(612302..613066)
Genome map
AA seq 254 aa AA seqDB search
MAENNIKLQVKNLNFYYGKFHALKGINLDIASRKVTAFIGPSGCGKSTLLRTFNRMFQLY
PGLNAEGEILLDGHNILGRDVDINLLRAKVGMVFQKPTPFPMSIYDNITFGVKLYEKLSK
AEMDDRVEWALRKAALWNEVKDKLKQSGNSLSGGQQQRLCIARAVASRPEVLLLDEPTSA
LDPISTAHIEELIHELKEDYTIAIVTHNMQQAARVSDYTAYMYLGEMVEFGDTDAIFTTP
KKKATEDYITGKFG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacaacatcaagcttcaggtcaagaatctgaacttttactacggcaagttt
cacgccctgaagggcatcaacctcgacatcgcctcgcgcaaggtgaccgccttcatcggc
ccctcgggctgcggcaaatcgaccctgctgcgcaccttcaaccgcatgttccagctctac
cccgggctgaacgcggaaggcgagatcctgctcgacggccacaacatcctcggccgcgac
gtcgacatcaacctgctgcgcgccaaggtcggcatggtgttccagaagccgacgccgttc
ccgatgtcgatctacgacaacatcaccttcggcgtgaagctgtacgagaagctgtcgaag
gcggagatggacgatcgcgtggaatgggcgctgcgcaaggcggcgctgtggaacgaggtg
aaggacaagctgaagcagtcgggcaactcgctgtccggcggccagcaacagcgcctgtgc
atcgcccgtgccgtggcttcgcgtccggaagtgctgctgctcgacgagccgacctcggcg
ctggacccgatctcgaccgcccacatcgaagagctgatccacgaactgaaagaggactac
accatcgccatcgtgacccacaacatgcagcaggcggcgcgggtatccgactacaccgcc
tacatgtacctgggcgaaatggtcgagttcggcgataccgatgcgatcttcaccacgccg
aagaagaaggcgaccgaggattacatcaccggcaagttcggctga

DBGET integrated database retrieval system