KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1004Help
Entry
NH8B_1004         CDS       T01619                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00270  Cysteine and methionine metabolism
pse00620  Pyruvate metabolism
pse00630  Glyoxylate and dicarboxylate metabolism
pse00680  Methane metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pse_M00012  Glyoxylate cycle
pse_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1004
   00620 Pyruvate metabolism
    NH8B_1004
   00630 Glyoxylate and dicarboxylate metabolism
    NH8B_1004
  09102 Energy metabolism
   00680 Methane metabolism
    NH8B_1004
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NH8B_1004
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     NH8B_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C DAP10
Motif
Other DBs
NCBI-ProteinID: BAK75836
UniProt: G2IZN8
LinkDB All DBs
Position
complement(1008671..1009648)
Genome map
AA seq 325 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLDLPQAQTAVKGVMMELEDC
AFPLLAGMIATDDPNVAFKDAQVALLVGARPRSKGMERKDLLEANGAIFTVQGKALNDHA
DRNVKVLVVGNPANTNAYIAMNSAPDLDPKNFTAMLRLDHNRALSQLAAKTGTAVSDIEH
MLVWGNHSPTMYADYRFATVNGESLKAKINDEAWNRDVFLPTVGKRGAAIIEARGLSSAA
SAANAAIDHIHDWVLGTNGKWVTMGIPSDGSYGIPEGVMYGFPVVCENGKYTIVQGLEID
EFSRERMNLTLAELEEERAGVAHLL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccctgtacgcgttgccgtgaccggtgcagccggccagattggttatagcctg
ctgttccgcattgccagcggtgaaatgctcggtaaagaccagcccgtcatcctgcaactt
ctggacctgccgcaggcccagaccgccgtcaaaggcgtgatgatggaactggaagactgc
gccttcccgctgctggccggcatgatcgccaccgacgacccgaacgtggctttcaaggat
gctcaggtcgccctgctggtcggcgcccgtccgcgcagcaaaggcatggaacgcaaggac
ctgctggaagccaacggcgccatcttcaccgttcagggcaaggcgctgaacgatcacgcc
gaccgcaacgtaaaagtactggtcgtcggcaacccggccaacaccaacgcctacatcgcc
atgaacagcgctccggacctcgatccgaaaaacttcaccgccatgttgcgccttgaccac
aaccgcgccctgtcgcagctcgcggccaagaccggtaccgccgtatccgacatcgagcac
atgctggtctggggcaaccactccccgaccatgtacgccgactaccgcttcgccaccgtg
aacggcgaatcgctcaaggccaagatcaacgacgaagcctggaaccgcgatgtgttcctg
ccgaccgtgggcaagcgcggcgccgccatcatcgaagcacgcggcctgtcgtcggccgcc
tcggctgccaacgccgccatcgaccacatccatgactgggtgctgggcaccaacggcaag
tgggtgaccatgggcatcccgtccgacggctcctacggcattccggaaggcgtcatgtac
ggcttcccggttgtgtgcgaaaatggcaaatacacgattgttcaaggccttgagatcgac
gagttcagccgcgaacgcatgaacctgaccctggccgaactggaagaagagcgcgcgggc
gttgcccatctgctctga

DBGET integrated database retrieval system