KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1008Help
Entry
NH8B_1008         CDS       T01619                                 

Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00190  Oxidative phosphorylation
pse00650  Butanoate metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pse_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1008
   00650 Butanoate metabolism
    NH8B_1008
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NH8B_1008
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NH8B_1008
    1.3.5.4  fumarate reductase (quinol)
     NH8B_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 TerB Thi4 FAD_binding_3 DAO GIDA GMC_oxred_N SVIP HI0933_like Pyr_redox_3 Lycopene_cycl NAD_binding_7 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: BAK75840
UniProt: G2IZP2
LinkDB All DBs
Position
1011577..1013343
Genome map
AA seq 588 aa AA seqDB search
MGVPVRRFDAVIVGGGGAGLRAALQLSESGLKTAVLSKVFPTRSHTVAAQGGISASLGNV
QEDHWEWHMYDTVKGSDWLGDQDAIEFMCRKAPDAVIELEHFGMPFDRLENGKIYQRPFG
GHTQNNGQTPVQRACAAADRTGHAMLHTLYQRNVRANTQFFVEWMALDLIRDADGDVVGV
TALEMETGEVFILHAKAVLFATGGAGRIYAASTNAFINTGDGLGMCVRAGIPLEDMEFWQ
FHPTGVAGAGVLITEGVRGEGGILLNANGERFMERYAPNLKDLAPRDFVARSMEQEVLEG
RGCGPNKDYVLLKLDHLGPDIIKQRLPGIREIAIKFAGVDPIKEPIPVIPTCHYMMGGIP
TNYRGEVVIPQGDNPESRVNGFFAAGECACASVHGANRLGTNSLLDLVVFGKSAGDSMVE
YIKNEMPTWKDLPADAADRSLARIARLDGQTNGEEVADVRTAMQRTVQARAAVFRNADNL
SKGVTEIQQVAERVKRTQIKDKSKVFNTARVEALELENLIEVAVATLIAADARKESRGAH
AHADFPNRDDEVWMKHSLYYGDERRLSYKPVHTKPLSVDYIPPKERTF
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtacctgttcgtcggtttgatgctgtcatcgttggcggcggtggcgcgggtctg
cgtgcggccctgcaattgtccgagtccggcctgaaaacggccgtactgtccaaagtattc
ccgacccgttcgcacacggttgcggcacagggtggcatttccgcctcgctcggcaacgtg
caggaagaccattgggaatggcatatgtacgacaccgtgaaggggtcggactggctgggt
gaccaggatgccatcgaattcatgtgccgcaaggcgcccgacgccgtgatcgagctcgag
catttcggcatgccgttcgaccgtctggaaaacggcaagatctaccagcgcccgtttggc
ggccatacccaaaacaatggccagactccggtgcagcgcgcctgtgctgcggccgaccgt
accggccatgccatgctgcacacgctgtatcagcgtaacgtgcgcgccaatacccagttc
ttcgtcgaatggatggcgctggacctgatccgcgacgccgacggcgatgttgtcggtgtg
accgcgctggaaatggaaaccggcgaagtgttcatcctgcacgccaaggcggtgctgttc
gccaccggcggtgccggccgtatctacgccgcgtcgaccaatgccttcatcaataccggc
gacggcctgggtatgtgcgtgcgtgccggcattccgctggaagacatggagttctggcag
ttccacccgaccggtgtggccggcgccggcgtgctgatcaccgaaggtgtgcgcggcgaa
ggcggtatcttgctgaacgccaacggcgaacgcttcatggagcgctacgcgccgaacctg
aaagacctggctccgcgtgactttgtcgcccgctcgatggagcaggaagtactggaaggc
cgtggctgcggtccgaacaaggactacgtgctgctcaagctggatcatctcggcccggac
atcatcaagcaacgtctgccgggtatccgcgagatcgccatcaagttcgccggcgtcgac
ccgatcaaggagccgatcccggtcatcccgacctgccactacatgatgggcggtattccg
accaactaccgtggcgaagtggtgatcccgcagggcgacaaccccgaatcccgcgtcaac
ggcttcttcgctgcgggcgaatgcgcctgcgcctcggtgcacggcgccaaccgcctcggc
accaactcgctgctcgatctggtggtattcggcaaatcggccggtgacagcatggtcgag
tacatcaagaacgagatgccgacctggaaggatttgccggccgacgctgccgatcgctcg
ctggcgcgcatcgcccgtctcgacggtcagaccaacggcgaagaagtggccgacgtgcgc
accgcgatgcagcgcaccgtccaggcccgtgctgccgtattccgcaacgcggacaacctg
tccaagggcgtgacggaaatccagcaggtggccgagcgcgtgaagcgcacccagatcaag
gacaagtccaaggtcttcaacaccgcccgcgtcgaagcactggaactggaaaacctgatc
gaagtcgccgtggcgaccctgattgccgccgacgcgcgcaaggagtcccgtggcgcccac
gcccacgccgacttcccgaaccgcgacgacgaggtctggatgaagcattccctgtactac
ggtgacgaacgtcgcctgagctacaagccggtacacaccaagccgttgtcggtggactac
atcccgccgaaagagcgtactttctaa

DBGET integrated database retrieval system