KEGG   Pseudogulbenkiania sp. NH8B: NH8B_1009Help
Entry
NH8B_1009         CDS       T01619                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00020  Citrate cycle (TCA cycle)
pse00190  Oxidative phosphorylation
pse00650  Butanoate metabolism
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01120  Microbial metabolism in diverse environments
pse01130  Biosynthesis of antibiotics
pse01200  Carbon metabolism
Module
pse_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pse_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pse_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NH8B_1009
   00650 Butanoate metabolism
    NH8B_1009
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NH8B_1009
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NH8B_1009
    1.3.5.4  fumarate reductase (quinol)
     NH8B_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_9 Fer4_7 Fer4
Motif
Other DBs
NCBI-ProteinID: BAK75841
UniProt: G2IZP3
LinkDB All DBs
Position
1013364..1014068
Genome map
AA seq 234 aa AA seqDB search
MKKMRFSIYRYDPDKDAKPYMQDYEVEIGPNDVKLLDVIVKLKTMDDTLSFRRSCREGIC
GSDAMNINGKNGLACITDIADLAEPITLRPLPGLPVIRDLIVDMTQFFKQYHSIKPYVVN
DSPRPERERLQSPEDRKELDGLYECILCACCSTSCPSFWWNPDKFVGPAGLLAAYRFIAD
TRDEATSERLDNLEDPYRLFRCHSIMNCVDVCPKGLNPTKAIGKIKDLMVRRAV
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatgcgtttttccatttaccgctacgatccggacaaggacgccaagccgtac
atgcaggattacgaggtcgaaatcggcccgaacgacgtgaaactgctggacgtcatcgtg
aagctgaagaccatggacgacaccctgtcgttccgccgctcctgccgcgaaggcatttgc
ggttccgacgccatgaacatcaacggcaagaacggcctggcctgcatcaccgatatcgcc
gacctggcggaaccgatcacgctgcgtccgttgcctggcctgccggtgatccgcgacctg
atcgtggacatgactcagttcttcaagcagtaccactcgatcaagccgtacgtggtcaac
gacagcccgcgtcctgagcgcgagcgcctgcagtcgccggaagaccgcaaggagctggac
ggcctgtacgagtgtatcctgtgcgcgtgctgctcgacgtcgtgtccgtcgttctggtgg
aacccggacaagttcgtcggcccggccggcctgctggccgcctaccgtttcattgcggat
acccgcgatgaagcgaccagcgagcgtctggataacctggaagatccgtaccgtctgttc
cgttgccactccatcatgaactgtgtcgacgtctgcccgaagggtctcaacccgaccaag
gcgatcggcaagatcaaggatctgatggtaaggcgtgcggtatga

DBGET integrated database retrieval system