KEGG   Pseudogulbenkiania sp. NH8B: NH8B_2455Help
Entry
NH8B_2455         CDS       T01619                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-binding
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NH8B_2455
Enzymes [BR:pse01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NH8B_2455
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NH8B_2455
    1.1.1.-  
     NH8B_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C DAO DUF2318
Motif
Other DBs
NCBI-ProteinID: BAK77269
UniProt: G2J5C4
LinkDB All DBs
Position
2582789..2583880
Genome map
AA seq 363 aa AA seqDB search
MNHPESMPTMRAAVWHGKNDIRVSDVPLPLSPGPGHVQIRVEWCGICGSDLHEYLAGPIF
IPVDTPHPLTGHKGQCILGHEFCGEITEIGSGVSGFRTGQRVAADACQHCGQCHYCQHGQ
YNLCESLAFTGLMTNGAFAQYVNVPANLLYPLPEHFPPEAGALIEPLAVGVHAVKQAGSL
VGKTVVVIGAGTIGLCTIMAARAAGASKIITLEMADARKRKALEVGATQVLDTSQCDAVA
VIKEMTGGYGADISFECIGHKATGPLAVEVIRKGGKAILVGIFEEPSQFNFFDLVATEKQ
LIGSLAYAGEFAHVIDLISDGRFDVTPLITGRIHLEEIVEKGFKELVANKDRNVKIIVSP
QPK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatcctgaatcgatgcctaccatgcgtgcggcggtgtggcacggtaaaaacgat
attcgcgtcagcgatgttccccttccgctgtccccgggcccaggccacgtccagatccgg
gtcgaatggtgcggcatatgtggttcggatctgcacgaatatctggctggaccgattttc
atcccggtcgacacgccgcatccgctgaccggacataagggccagtgcattcttggtcat
gaattttgtggcgagattaccgaaatcggcagcggtgtcagcggtttcaggacagggcaa
cgggtggcggccgacgcctgccagcattgcggccaatgtcattattgccagcacggccag
tacaatttatgcgaaagcctggcgtttacgggactgatgaccaatggcgccttcgcccaa
tacgtgaacgtgccggccaacctgttgtatcccttgccagagcacttcccgcccgaggcc
ggcgcgttgatcgaacccttggccgtgggggtgcacgccgtcaagcaggccggctcgctg
gtcggcaagacggtagtggtgatcggcgccggcaccatcggcttgtgtaccatcatggcg
gcccgggcggcgggcgccagcaagatcattaccctggaaatggccgatgcccgcaaacgc
aaggcgctggaagtgggcgccacgcaggtgctcgatacctcgcaatgcgacgccgtggcc
gtcatcaaggaaatgacgggcggctacggcgccgatatttctttcgaatgcatcggacac
aaggccaccgggccgcttgcggtcgaggtgatccgcaagggcggcaaagcgatactggtc
ggcattttcgaagagccgagccagttcaatttcttcgatctggtcgccaccgagaaacag
ctgattggctccctcgcctacgccggcgaattcgcccatgtcatcgacctgatcagcgat
ggccgcttcgatgtcaccccgctgattaccggcaggattcatctcgaggagattgtcgaa
aagggcttcaaggaactggtcgccaataaggacaggaacgtgaagataatcgtcagcccg
caaccgaagtag

DBGET integrated database retrieval system