KEGG   Pseudogulbenkiania sp. NH8B: NH8B_3691Help
Entry
NH8B_3691         CDS       T01619                                 

Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pse  Pseudogulbenkiania sp. NH8B
Pathway
pse00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pse01100  Metabolic pathways
pse01110  Biosynthesis of secondary metabolites
pse01130  Biosynthesis of antibiotics
pse01230  Biosynthesis of amino acids
Module
pse_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pse00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NH8B_3691
Enzymes [BR:pse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     NH8B_3691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 ATP_bind_2 dNK AAA AAA_17 AAA_16 TsaE GxGYxYP_C APS_kinase AAA_22
Motif
Other DBs
NCBI-ProteinID: BAK78439
UniProt: G2J0E0
LinkDB All DBs
Position
3878716..3879264
Genome map
AA seq 182 aa AA seqDB search
MDTLAGNFFLVGLMGAGKTTVGRALARKTGKTFYDSDHEIEAKTGVKVATIFEIEGEQRF
RDRESCAIAELVQRDNIILATGGGAILRPENRQLLKDNGVVIYLRANIDDLLARTQHDRN
RPLLQTADPKAKLESLLKERDPLYTEVADLIVDTTQQNVNLLVSQLEAQLFERQHRHQDS
RP
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggatacactggcaggcaatttttttcttgtcggactgatgggagccggcaagacgacg
gtaggccgtgcgctggcgcgcaaaaccggcaagaccttttacgactccgatcacgaaatc
gaggccaaaacgggcgtcaaggtcgccaccatcttcgaaatagaaggcgagcagcgtttt
cgtgatcgggagagttgcgccatcgccgaactggtgcaacgcgacaacatcatcctggcg
acaggaggcggagccatcctgcgcccggaaaatcgccagttgctgaaagacaacggagtc
gtgatttacctgcgtgccaatatcgatgacctgttggcccgaacccagcatgaccgcaac
cgtcccctgctccagaccgctgaccccaaggccaagctggaaagtctgctcaaggaacgc
gacccgctctacaccgaggtggcggacctgatcgtcgacaccacccagcaaaacgtcaac
ctgctggtcagtcaacttgaagcacagctgttcgagcgccaacaccgccatcaagactcc
cgaccatga

DBGET integrated database retrieval system