KEGG   Pseudogulbenkiania sp. NH8B: NH8B_4102Help
Entry
NH8B_4102         CDS       T01619                                 

Definition
(GenBank) two component transcriptional regulator
  KO
K02483  two-component system, OmpR family, response regulator
Organism
pse  Pseudogulbenkiania sp. NH8B
Brite
KEGG Orthology (KO) [BR:pse00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pse02022]
    NH8B_4102
Two-component system [BR:pse02022]
 OmpR family
  Unclassified
   NH8B_4102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C Response_reg FleQ
Motif
Other DBs
NCBI-ProteinID: BAK78839
UniProt: G2J2W3
LinkDB All DBs
Position
complement(4301557..4302285)
Genome map
AA seq 242 aa AA seqDB search
MDDKHRILIVDDETEVRDWLGALLEDGGFAPHGVADGAAMRQALAAQRFALVILDLRLKG
EDGLMLARELRGQSAVPIIMMSGKGDETDRVLGLELAADDYLTKPFSGRELLARVRAALR
RTTELSIPLQRHPGEAHECYAFNGWLLDLTARELRQPDGTPCALTQGEFSLLATLVRHPQ
RVWSREQLLEQTRGLDTEVYDRTIDVLILRLRRKIEPNPRHPELICTERGLGYQFRAAVS
RP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaagcaccgcatcctgatcgtcgacgacgagaccgaggtgcgcgactggctc
ggcgcgctgctggaggacggcggcttcgccccgcacggcgtggccgacggcgcggcgatg
cgccaggccctggccgcacagcgcttcgcgctggtgatcctcgacctcaggctcaagggc
gaggacggcctgatgctggcgcgcgagctgcgcggccagtccgccgtgccgatcatcatg
atgagcggcaagggcgacgagaccgaccgcgtgctggggctggaactggccgccgacgac
tacctgaccaagccgttctccgggcgcgaactgctggcgcgcgtgcgcgccgcgctgcgc
cgcaccaccgagctgtcgatcccgctgcagcgccacccgggcgaggcgcacgagtgctac
gccttcaacggctggctgctcgacctgaccgcgcgcgagctgcgccagccggacggcacg
ccgtgcgcgctgacgcagggcgagttctcgctcttggccacgctggtgcgccacccgcag
cgggtgtggagccgcgagcagctgctggagcagacacgcggcctcgacaccgaggtgtac
gaccgcaccatcgacgtgctgatcctgcgcctcaggcgcaagatcgagccgaacccgcgc
caccccgaactgatctgcaccgagcgcggcctgggctaccagttccgcgccgcggtcagc
cgcccttga

DBGET integrated database retrieval system