KEGG   Pseudonocardia sp. AL041005-10: WY02_03110Help
Entry
WY02_03110        CDS       T04051                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00250  Alanine, aspartate and glutamate metabolism
psea00410  beta-Alanine metabolism
psea00430  Taurine and hypotaurine metabolism
psea00650  Butanoate metabolism
psea01100  Metabolic pathways
psea01110  Biosynthesis of secondary metabolites
psea01120  Microbial metabolism in diverse environments
psea02024  Quorum sensing
Module
psea_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    WY02_03110
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WY02_03110
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WY02_03110
   00430 Taurine and hypotaurine metabolism
    WY02_03110
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    WY02_03110
Enzymes [BR:psea01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     WY02_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ALE77603
UniProt: A0A0M4PZN0
LinkDB All DBs
Position
797131..798525
Genome map
AA seq 464 aa AA seqDB search
MPGAHSPSEDRGDDRAVPVNPVFAAEPVDIPRFRIPGTGMHPEVAYQVVHDELMLDGNAR
LNLATFVTTWAEPQAERLMAESFDKNMIDKDEYPRTADLEQRCVRMLADLWHAPDPGRAV
GCSTTGSSEACMLGGLALKRRWQHRRKAAGLPADRPNIVMGVNVQICWDKFANYWDVEPR
LVPMEGDRLHLGVEEAVALCDENTIGVVAILGSTFDGSYEPVAQLCAALDDLQSRTGLDV
PVHVDGASGAMIAPFCDPDLEWDFRLPRVASINTSGHKYGLVHPGVGWAVWRDTDALPED
LVFRVNYLGGDMPTFALNFSRPGGQVIAQYYNFLRLGHEGYARVQGTCREIATGLARRIE
ATGAFRLLTDGSQLPVFAFTVADGEPFSVFDVSAGLRETGWLVPAYTFPENREDLAALRI
VVRNGFSHDLAALLLDDLARLLERLRRQAGPVRGSEAAGFAHGT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgcgcactcaccctcggaggaccgcggcgacgaccgcgcggtcccggtcaac
cccgtcttcgccgcggagcccgtcgacatcccccgcttccgcatccccggcaccgggatg
cacccggaggtcgcctaccaggtcgtgcacgacgagctgatgctcgacgggaacgcccgg
ctgaacctcgccacgttcgtcacgacgtgggcggagccccaggccgagcggctgatggcc
gagtccttcgacaagaacatgatcgacaaggacgagtacccgcggacggcggacctggag
cagcggtgcgtgcggatgctcgccgacctgtggcacgcccccgacccggggcgggccgtc
ggctgctcgacgacggggtcgtcggaggcgtgcatgctcggcgggctggcgctcaagcgg
cgctggcagcaccggcggaaggcggcgggtctcccggcggaccggccgaacatcgtgatg
ggtgtgaacgtccagatctgctgggacaagttcgcgaactactgggacgtggagccgcgg
ctggtcccgatggagggcgaccggctgcacctgggcgtcgaggaggccgtcgcgctgtgc
gacgagaacaccatcggcgtcgtcgcgatcctcgggtccaccttcgacggcagctacgag
ccggtcgcgcaactgtgcgcggcgctcgacgacctgcagtcccgcaccgggctggacgtg
ccggtgcacgtcgacggcgcgtccggggcgatgatcgcgccgttctgcgacccggacctg
gagtgggacttccggctgccgcgggtggcgtcgatcaacacctccggccacaagtacggc
ctggtgcacccgggcgtcgggtgggcggtgtggcgcgacaccgacgcgctgcccgaggac
ctggtgttccgggtgaactacctcggcggtgacatgccgacgttcgcgctgaacttctcc
cgccccggcggccaggtgatcgcccagtactacaacttcctgcggctggggcacgagggc
tacgcccgggtgcagggcacctgccgggagatcgcgaccgggctggcccggcggatcgag
gcgacgggtgcgttccggctgctcaccgacggctcgcagctgccggtgttcgcgttcacc
gtcgccgacggcgagccgttctcggtgttcgacgtgtcggcgggtctgcgcgagacggga
tggctggtcccggcatacacgttcccggagaaccgcgaggacctggcggcgctgcggatc
gtggtccgcaacgggttcagccacgacctggccgcgctgctgctcgacgacctggcgcgg
ctgctggagcggctgcgccgccaggccggtcccgtccgcgggagcgaggccgcgggcttc
gcccacgggacgtga

DBGET integrated database retrieval system