KEGG   Pseudonocardia sp. AL041005-10: WY02_10330
Entry
WY02_10330        CDS       T04051                                 

Definition
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea03030  DNA replication
psea03410  Base excision repair
psea03420  Nucleotide excision repair
psea03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:psea00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    WY02_10330
   03410 Base excision repair
    WY02_10330
   03420 Nucleotide excision repair
    WY02_10330
   03430 Mismatch repair
    WY02_10330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:psea03032]
    WY02_10330
   03400 DNA repair and recombination proteins [BR:psea03400]
    WY02_10330
Enzymes [BR:psea01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     WY02_10330
DNA replication proteins [BR:psea03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     WY02_10330
DNA repair and recombination proteins [BR:psea03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     WY02_10330
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     WY02_10330
   MMR (mismatch excision repair)
    DNA ligase
     WY02_10330
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WY02_10330
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD PTCB-BRCT Auto_anti-p27
Other DBs
NCBI-ProteinID: ALE78762
UniProt: A0A0M5LR77
LinkDB
Position
complement(2293434..2295890)
AA seq 818 aa
MSGVAANLRVVSSQSDAPQARERHAQLAAEVADHQFRYYVLDAPVVSDGQFDELWHELLA
LEEAHPELVTPDSPSQRVGGTFSTDFTAHDHLERMLSLDNAFSPEDLRTWQERVTKEVGE
DLHYLCELKIDGLAVNLLYTDGRLTRALTRGDGRTGEDITLNMRTLAEVPEQLTGTDEFP
VPALVEVRGEVYFRLEDFERLNASLVEAGKEPFANPRNTAAGSLRQKDPRVTGSRNLRLI
CHGLGKREGFTPDTQSHAYDALVAWGLPISPRTTVLQGIEKVIEYVEHWGEHRHDVEHEI
DGVVVKVDEVALQRRLGATSRFPRWAIAYKYPPEQATTRLIDIRVNVGRTGRVTPFAVME
PVKVAGSTVEMATLHNADEVRRKGVLIGDRVVIRKAGDVIPEVLGPVTDVRDGSEREFVM
PTHCPECGTALVQQKAGDVDRRCPNARSCPAQLRERLFHVAGRGAFDIEGLGYEAAVALL
TSGVLTDEGDVFALTEDDLLRTELFRNQKGELTVNGRKLLTNLEAAKDRPLWRVLVGLSI
RHVGPTAAQALGREFGSMEALERAAAQAKADTEAAGVAIVSDGTAGEDDAAAEASAPTAE
GAAAEAAGDVETAEAEAATAAGAADSPQAVDGDTGVDGAEGVDGAENADESADAAAAAAA
EAAKQERAAARARAKAVAEALAPIAGVDGVGPTIAAAVRDWFSVDWHREVVQKWRAAGVA
MEDEVDDSVPRFLEGLSIVITGSMENWSRDEAKEAIMARGGRAAGSVSKKTAFVVAGEAP
GSKYDKAVELGVPVLDEAGFSVLLDRGPDAAREQAADA
NT seq 2457 nt   +upstreamnt  +downstreamnt
ctgtcgggggtcgccgctaacctgcgcgtcgtgagctcccagtccgacgccccgcaggcc
cgcgagcgccacgcgcagctggcggccgaggtggccgaccaccagttccggtactacgtg
ctggacgcgccggtcgtctccgacggccagttcgacgagctgtggcacgagctgctcgcg
ctggaggaggcgcaccccgagctggtcacgccggactcgccgagccagcgcgtcggcggc
acgttctccaccgacttcaccgcccacgaccatctcgagcggatgctgtcgctggacaac
gccttctcgcccgaggacctgcgcacgtggcaggagcgggtgacgaaggaggtcggcgag
gacctgcactacctgtgcgagctcaagatcgacggactggcggtgaacctgctctacacc
gacgggcggctcacccgcgcgctgacccgcggtgacgggcgcaccggtgaggacatcacg
ctcaacatgcgcaccctcgccgaggtgcccgagcagctcaccggcaccgacgagttcccg
gtgccggcgctcgtcgaggtccggggcgaggtctacttccggctggaggacttcgagcgc
ctcaacgcctcgctggtcgaggcgggcaaggagccgttcgcgaacccccgcaacaccgcg
gccggctcgctgcggcagaaggacccgcgggtcaccggctcgcgcaacctgcggctgatc
tgccacggtctgggcaagcgggaggggttcacccccgacacccagtcccacgcctacgac
gcgctggtcgcctggggcctgccgatctccccgcgcacgaccgtgctgcagggcatcgag
aaggtgatcgagtacgtcgagcactggggcgagcaccggcacgacgtcgagcacgagatc
gacggcgtcgtcgtgaaggtcgacgaggtggctctgcagcgcagactcggtgcgacctcc
cggttcccgcgctgggcgatcgcctacaagtacccgccggagcaggccaccacgcggctg
atcgacatccgggtcaacgtcgggcgcaccggccgggtcaccccgttcgcggtgatggag
ccggtgaaggtcgccgggtccacggtcgagatggcgaccctgcacaacgccgacgaggtg
cgccgcaagggtgtgctgatcggcgaccgggtggtcatccgcaaggcgggcgacgtgatc
cccgaggtgctggggccggtcaccgacgtgcgcgacggctccgagcgcgagttcgtgatg
ccgacgcactgccccgagtgcggcaccgcgctcgtgcagcagaaggcgggcgacgtcgac
cggcgctgtccgaacgcccgctcctgcccggctcagctgcgggagcggctgttccacgtc
gcgggccgcggcgcgttcgacatcgaggggctcggctacgaggccgcggtggcgctgctg
acctcgggcgtgctgaccgacgagggtgacgtgttcgccctgaccgaggacgacctgctg
cggaccgagctgttccgcaaccagaagggcgagctgacggtcaacggccgcaagctgctc
acgaacctggaggcggcgaaggaccggccgctgtggcgggtcctggtgggactgtcgatc
cgccacgtcgggccgaccgccgcgcaggcgctgggccgtgagttcgggtcgatggaggcc
ctggaacgcgccgcggcgcaggcgaaggcggacaccgaggcggccggggtcgcgatcgtc
tccgacgggacggcgggggaggacgacgcagcggccgaggcctcggcgccgacggccgag
ggtgccgccgccgaggcggccggcgacgtcgagaccgcggaggcggaggctgcgaccgcc
gccggggcggcggactccccgcaggccgtggacggcgacacgggtgtggacggcgccgag
ggcgtggacggcgcggagaacgccgacgagagcgccgacgcggcggccgccgcggccgcc
gaggccgcgaagcaggagcgggcggccgcgcgcgcccgggcgaaggccgtggccgaggcg
ctcgccccgatcgccggggtcgacggtgtgggcccgaccatcgcggcggcggtgcgggac
tggttctccgtcgactggcaccgcgaggtcgtgcagaagtggcgggcggcgggcgtcgcg
atggaggacgaggtcgacgactcggtgccccgcttcctggagggcctctcgatcgtgatc
accggctcgatggagaactggtcccgcgacgaggccaaggaggcgatcatggcccgcggc
gggcgcgcggccgggtcggtgtcgaagaagacggcgttcgtcgtcgcgggggaggcgccc
ggctcgaagtacgacaaggccgtcgagctcggggtgccggtgctggacgaggccgggttc
tcggttctgctcgaccgcggtcccgatgcggcgcgcgagcaggccgccgacgcctga

DBGET integrated database retrieval system