KEGG   Pseudonocardia sp. AL041005-10: WY02_15480Help
Entry
WY02_15480        CDS       T04051                                 

Definition
(GenBank) L-cystine-binding protein TcyA
Organism
psea  Pseudonocardia sp. AL041005-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Phosphonate-bd DUF3710 YhfZ_C Lig_chan-Glu_bd NMT1
Motif
Other DBs
NCBI-ProteinID: ALE79604
UniProt: A0A0M4PTF8
LinkDB All DBs
Position
3357411..3358163
Genome map
AA seq 250 aa AA seqDB search
MRRTILALAAALLALTTLVGCSSGGSDTLRVGTEGTYSPFSFQGPDGQLTGYDVEVARAV
GAKLGKEVEFVQTPWDSIFAALESKRIDLVANQVTVNDERKARYDLSTPYTVSEGVIVTR
ADDTTIRSLADLRGRTTAQSATSNWAEVARGAGANVEAVEGFVQAVQLVKDGRVDATVND
NLAVGEYEKSTGDKGVKVAGTTGDTSEQAFAARKDSGLMPDVDRALTELRADGTLKQLSE
KYFGSDVSGK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtcgcacgatcctggccctggccgccgcgctgctggccctcaccaccctcgtcggc
tgcagcagcggcgggtccgacacgctgcgcgtcggcaccgaggggacctacagccccttc
agcttccagggccccgacggtcagctgaccggctacgacgtcgaggtcgcccgtgcggtc
ggcgccaagctgggcaaggaggtcgagttcgtccagaccccgtgggactcgatcttcgcc
gcgctcgagtcgaagcggatcgacctggtcgccaaccaggtcacggtcaacgacgagcgg
aaggccaggtacgacctctccacgccctacaccgtgtccgagggcgtgatcgtcacccgc
gccgacgacaccacgatccggagcctggccgacctgcggggccgcaccaccgcccagtcc
gcgaccagcaactgggccgaggtcgcccgcggcgccggcgcgaacgtcgaggcggtggag
ggcttcgtgcaggccgtccagctcgtcaaggacggccgggtcgacgccaccgtcaacgac
aacctcgccgtcggggagtacgagaagtcgaccggggacaagggtgtcaaggtcgccggc
accaccggggacaccagcgagcaggccttcgccgcccgcaaggacagcggcctgatgccc
gacgtggaccgggcgctgaccgagctgcgggccgacggcacgctgaagcagctgtccgag
aagtacttcggcagcgacgtcagcgggaagtag

DBGET integrated database retrieval system