KEGG   Pseudonocardia sp. AL041005-10: WY02_19460Help
Entry
WY02_19460        CDS       T04051                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00071  Fatty acid degradation
psea00280  Valine, leucine and isoleucine degradation
psea00281  Geraniol degradation
psea00310  Lysine degradation
psea00362  Benzoate degradation
psea00380  Tryptophan metabolism
psea00410  beta-Alanine metabolism
psea00640  Propanoate metabolism
psea00650  Butanoate metabolism
psea00903  Limonene and pinene degradation
psea00930  Caprolactam degradation
psea01100  Metabolic pathways
psea01110  Biosynthesis of secondary metabolites
psea01120  Microbial metabolism in diverse environments
psea01130  Biosynthesis of antibiotics
psea01200  Carbon metabolism
psea01212  Fatty acid metabolism
Module
psea_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WY02_19460
   00650 Butanoate metabolism
    WY02_19460
  09103 Lipid metabolism
   00071 Fatty acid degradation
    WY02_19460
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WY02_19460
   00310 Lysine degradation
    WY02_19460
   00380 Tryptophan metabolism
    WY02_19460
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WY02_19460
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    WY02_19460
   00281 Geraniol degradation
    WY02_19460
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WY02_19460
   00930 Caprolactam degradation
    WY02_19460
Enzymes [BR:psea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     WY02_19460
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     WY02_19460
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     WY02_19460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DAO NAD_binding_2 AlaDh_PNT_C UDPG_MGDP_dh_N NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ALE80236
UniProt: A0A0M4Q914
LinkDB All DBs
Position
4152429..4154606
Genome map
AA seq 725 aa AA seqDB search
MTEQKAVRWESDADGVAVVTLDDPASSANTMNDAYREAMREVVDDLEKHKDDIVGVVVTS
AKKTFFAGGNLEQLSAAGPDDAEKIFELVTEVKAQLRKLETFGRPVASALVGTALGGGLE
IALATHHRVGVDAKGVVYGLPEVSLGLLPGGGGVTRVTRMLGIANGFMNVLAQGQRHKPA
KALELGLIDELAATREEAFDKARAWVLANPEHTTQPWDQPKYRIPGGTPSSPSLASILPA
FPANLRKQLKGAPMPAPRNILAAAVEGSQVDFETAQKIEGRYFAELVTGQVSKNMTKAFF
FDLNAINGGKSRPDGPAKWQPTKVAVLGAGMMGAGIAYVCSLAGWDVVLKDVSKEAAEKG
KAYSQGLVEKGVKRGKTTQEKGDALLGRILPTDDYADLAGCDVVIEAVFESVELKQEVFR
EAAKYINSDALLCSNTSTLPITELAKGVDRPDDFIGLHFFSPVDKMPLVEIIKGERTNDE
ALAKAFDLTLGIRKTPIVVNDSRGFFTSRVIGTFINEGVAMIAEGIDPQTIEQASSQAGY
PAPVLQLMDELTLTLPRKIREETKKGVEAAGGTWTPHPSDPVIDRLVDEFDRKGKSTGAG
FYEYSDGKRTGLWPGLREHFGATNHDVDLHELSERMLIIESIETVKCVDEGVLTTVADAN
IGSIFGIGFPAWTGGVLQYIEGYPGGPAGFVARADELKAKYGERFEVPQSLRDRAAKGES
ATAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagcagaaggccgtccgctgggagtccgacgccgacggcgtcgccgtcgtcacc
ctcgacgacccggccagcagcgccaacaccatgaacgacgcctaccgcgaggccatgcgg
gaggtcgtcgacgatctggagaagcacaaggacgacatcgtcggtgtcgtcgtcacctcg
gccaagaagaccttcttcgccggcgggaacctcgagcagctcagcgcggccggtcccgac
gacgccgagaagatcttcgagctggtgaccgaggtcaaggcccagctgcgcaagctggag
accttcggccgcccggtcgcgtccgcgctcgtcggcaccgccctgggcggtggcctggag
atcgcgctggcgacccaccaccgggtcggcgtcgacgcgaagggcgtcgtctacggcctg
cccgaggtgagcctgggcctgctgcccggtggcggcggcgtcacccgcgtcacccgcatg
ctgggcatcgcgaacggcttcatgaacgtcctcgcgcagggccagcggcacaagccggcc
aaggcgctggagctcggcctgatcgacgagctcgcggccacccgcgaggaggccttcgac
aaggcccgggcgtgggtgctcgccaaccccgagcacaccacccagccctgggaccagccg
aagtaccggatccccggcggcacgccgtcgagcccctcgctggcctcgatcctcccggcg
ttcccggcgaacctgcgcaagcagctcaagggcgcgccgatgcctgccccgcgcaacatc
ctcgcggccgccgtcgagggcagccaggtcgacttcgagaccgcgcagaagatcgagggc
cgctacttcgcggagctcgtgaccggccaggtctcgaagaacatgaccaaggcgttcttc
ttcgacctcaacgccatcaacggcggcaagtcccgcccggacggccccgcgaagtggcag
ccgaccaaggtcgccgtgctcggcgccgggatgatgggcgcgggcatcgcctacgtctgc
tccctcgccggctgggacgtcgtcctcaaggacgtctcgaaggaggccgccgagaagggc
aaggcctactcgcagggtctcgtcgagaagggcgtcaagcgtgggaagaccacgcaggag
aagggcgacgcgctgctcggccgcatcctgccgaccgacgactacgccgacctcgccggc
tgcgacgtcgtcatcgaggccgtcttcgagtccgtcgagctgaagcaggaggtgttccgc
gaggccgcgaagtacatcaactccgacgcgctgctgtgctcgaacacctcgacgctgccc
atcaccgagctggccaagggcgtcgaccgcccggacgacttcatcggtctgcacttcttc
tcgccggtcgacaagatgccgctggtcgagatcatcaagggtgagcgcacgaacgacgag
gccctggccaaggcgttcgacctgacgctggggatcaggaagaccccgatcgtcgtcaac
gactcccgcggcttcttcaccagccgcgtgatcggcaccttcatcaacgagggcgtcgcg
atgatcgccgagggcatcgacccgcagacgatcgagcaggcgtcgtcgcaggccgggtac
ccggccccggtgctgcagctgatggacgagctgaccctcacgctgccgcgcaagatccgc
gaggagacgaagaagggcgtcgaggccgccggcggcacctggaccccgcacccgtccgac
ccggtgatcgaccggctggtcgacgagttcgaccgcaagggcaagagcaccggcgccggg
ttctacgagtactccgacggcaagcgcaccggcctctggcccggcctgcgcgagcacttt
ggcgcgacgaaccacgacgtcgacctgcacgagctgtccgagcggatgctcatcatcgag
tcgatcgagaccgtgaagtgcgtcgacgagggcgtgctgaccaccgtcgccgacgccaac
atcggctcgatcttcggcatcggcttcccggcctggaccggcggcgtgctgcagtacatc
gagggctaccccggcggcccggccggcttcgtggcccgcgccgacgagctgaaggcgaag
tacggcgagcgcttcgaggtcccgcagtcgctgcgtgaccgcgcggcgaagggggagtcg
gccaccgcggccgcctga

DBGET integrated database retrieval system