KEGG   Pseudonocardia sp. AL041005-10: WY02_21360Help
Entry
WY02_21360        CDS       T04051                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00250  Alanine, aspartate and glutamate metabolism
psea00410  beta-Alanine metabolism
psea00640  Propanoate metabolism
psea00650  Butanoate metabolism
psea01100  Metabolic pathways
psea01120  Microbial metabolism in diverse environments
Module
psea_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:psea00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    WY02_21360
   00650 Butanoate metabolism
    WY02_21360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WY02_21360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WY02_21360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psea01007]
    WY02_21360
Enzymes [BR:psea01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     WY02_21360
Amino acid related enzymes [BR:psea01007]
 Aminotransferase (transaminase)
  Class III
   WY02_21360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALE80537
UniProt: A0A0M5LS13
LinkDB All DBs
Position
4526903..4528159
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLYDTDGRRHLDFTAGIGVTSTGHCHPTVVAAAQEQVA
TLIHGQYTTVMHQPLLTLVERMGDVLPEGIDSVFFTNSGSEAVEASVRLARQATGRQLIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFAPFPYAYRYGWSEEQAVAFALSEL
DRQLASTAPASDVAAFIVEPVLGEGGYVPTPPAFLHGLRERADRHGILLIADEVQTGYGR
TGKFWGHQHAEGLTPDIIVTAKGLASGFPLSAIAAPKALMEKAWPGSQGGTYGGNAVACA
AALATLEVVQGEGLVENARVQGEKLLAGVRDAAQGIAAIGDVRGRGLMVGIEFVDADGKP
DGATAAKVHAAAAAQGLLLLTCGVYGNVVRMIPALVVTAEQVDEGLALWTKALNDALS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctcaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctacctgtacgacaccgatgggcgccgccacctcgacttcaccgccggcatcggc
gtcacctccaccgggcactgccacccgacggtcgtcgcggccgctcaggagcaggtggcc
acgctgatccacggccagtacacgaccgtgatgcaccagccgctgctgacgctggtcgag
cggatgggcgacgtgctgcccgagggcatcgactcggtgttcttcaccaactccggctcc
gaggccgtcgaggcgtcggtgcggctggcccgccaggccaccggccggcagctgatcgtc
gcgttcgacggcggcttccacggacgcaccatgggtgccgcggcgctcaccacctccggg
gcgaagatccgggccgggatcggtccgatgatgggcggggtcgcgttcgcgcccttcccc
tacgcctaccgctacggctggtccgaggagcaggccgtcgcgttcgccctgtccgagctc
gaccggcagctggcgagcaccgcgccggcgtccgacgtcgccgcgttcatcgtcgagccg
gtgctcggcgagggcggctacgtcccgaccccgcccgcgttcctgcacgggctgcgcgag
cgcgccgaccggcacggcatcctgctgatcgccgacgaggtccagaccggctacggccgc
accgggaagttctggggccaccagcacgccgagggcctcaccccggacatcatcgtcacc
gccaaggggctcgcgtccggcttcccgctctcggccatcgccgcgccgaaggccctcatg
gagaaggcgtggcccggctcgcagggcggtacctacggcggcaacgccgtcgcctgtgcc
gccgcgctcgccacgctcgaggtcgtgcagggcgagggcctggtcgagaacgcccgcgtg
cagggcgagaagctcctcgccggcgtccgggacgccgcacagggcatcgccgccatcggc
gacgtccgaggccggggcctgatggtcgggatcgagttcgtcgacgccgacggcaagccc
gacggcgccaccgcggcgaaggtgcacgccgcggccgccgcgcagggcctgctcctgctg
acctgcggtgtgtacggcaacgtcgtccggatgatcccggcgctcgtcgtgaccgccgag
caggtcgacgagggcctggcgctctggaccaaggcactgaacgacgcgctgtcctga

DBGET integrated database retrieval system