KEGG   Pseudonocardia sp. AL041005-10: WY02_22640Help
Entry
WY02_22640        CDS       T04051                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
psea  Pseudonocardia sp. AL041005-10
Brite
KEGG Orthology (KO) [BR:psea00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    WY02_22640
Enzymes [BR:psea01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     WY02_22640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ALE80743
UniProt: A0A0M4QP51
LinkDB All DBs
Position
complement(4793480..4793887)
Genome map
AA seq 135 aa AA seqDB search
MRLSRILRPRLEATAHCDLPCGVYDPAQARIEAESVKAIQEKYQGNEDVDFRARAIEIKE
QRSDLVKHHLWVLWTDYFKPPHFEKYPELHELFNKATKAAGASGTKGSNDPATGQELLDY
IAQIDKIFWETKQAA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgtcccgcattctccgtccgcgactggaggccaccgcgcactgcgacctcccc
tgcggcgtgtacgacccggcccaggcccggatcgaggccgagtcggtcaaggcgatccag
gagaagtaccagggcaacgaggacgtggacttccgggcccgcgccatcgagatcaaggag
cagcgctccgacctggtcaagcaccacctgtgggtgctctggaccgactacttcaagccg
ccgcacttcgagaagtacccggagctgcacgagctgttcaacaaggccaccaaggccgcc
ggcgcgtcgggcaccaagggctcgaacgacccggccaccggccaggagctgctcgactac
atcgcccagatcgacaagatcttctgggagaccaagcaggctgcctga

DBGET integrated database retrieval system