KEGG   Pseudonocardia sp. AL041005-10: WY02_23095Help
Entry
WY02_23095        CDS       T04051                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psea  Pseudonocardia sp. AL041005-10
Pathway
psea00564  Glycerophospholipid metabolism
psea01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psea00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    WY02_23095
Enzymes [BR:psea01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     WY02_23095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 GIDA PrkA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ALE80812
UniProt: A0A0M5LW75
LinkDB All DBs
Position
complement(4898717..4900429)
Genome map
AA seq 570 aa AA seqDB search
MKSVALSPEARTTALQAMGDRELDVLVVGGGVVGAGAALDAATRGLTTGLVEARDFASGT
SSRSSKLIHGGLRYLEMLDFRLVAEALQERGLLIQTLAPHLVRPVPFVYPLKHHVWERFY
AGAGVALYDSLGLLSGRARGLPHHRHLTRRGARKVVPSLRKDALVGALEYYDAQVDDARH
TMEIARTAAAYGAHVATRARVVGLLKDSGRVIGATVQDLESGDRFDVRAKQVINATGVWT
DDTQGLAGERGQFKVRASKGIHLVVPRDRIRGDAGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASAADIEYLLAHVNEVLEQPLTHEDVEGVYAGLRPLLHGESEATSKLSR
EHAVATPVPGLVVVAGGKYTTYRVMAEDAVDAAVHSLDAKVPASCTEKVPLLGAEGFTAL
RNSTHQLAARSGLHPVRIEHLLGRYGSLIDEVLDLLIADPTLAEPLTGAEDYLRAEVVYG
ASHEGARHLEDILARRTRISIETFDRGVGAAEETATLVAPVLGWNDEQIAREVDHYVKRV
EAERESQKMPDDATADAARLGAPDVVPVSG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtggcgctctccccggaggcccgtaccacggcgctgcaggcgatgggcgac
cgtgaactggacgtgctcgtcgtcggcggtggcgtcgtcggcgccggtgccgccctcgac
gcggccacccgtggtctgacgaccggcctggtcgaggcccgcgacttcgcgtccggcacg
tcgagccgttcctccaagctcatccacggcggcctgcgctacctggagatgctcgacttc
cgcctggtggccgaggcactgcaggagcgggggctgctgatccagaccctcgcgccgcac
ctggtccgcccggtgccgttcgtctacccgctcaagcaccacgtgtgggagcgcttctac
gccggtgccggcgtcgcgctctacgactcgctcgggctgctgtccggccgtgcccgcggc
ctgccgcaccaccggcacctcacccgtcgcggcgcccgcaaggtcgtcccgtcgctgcgc
aaggatgccctggtcggggccctggagtactacgacgcccaggtcgacgacgcccgccac
accatggagatcgcccgcaccgcggccgcctacggcgcgcacgtggcgacccgtgcccgc
gtcgtcggactgctgaaggactccggccgcgtgatcggcgcgaccgtgcaggacctggag
tccggggaccgcttcgacgtccgcgccaagcaggtcatcaacgccaccggggtgtggacc
gacgacacccagggcctcgccggcgaacgcggtcagttcaaggtgcgcgcgtccaagggc
atccacctggtcgtcccgcgcgaccgcatccgcggcgacgccgggctgatcctgcgcacc
gagaagtcggtgctgttcgtcatcccgtggggccggcactggatcatcggcaccaccgac
accgactgggacctggacaaggcgcacccggcggcgagcgcggccgacatcgagtacctg
ctcgcgcacgtcaacgaggtgctggagcagccgctgacccacgaggacgtcgagggcgtc
tacgccggtctgcgcccgctgctgcacggcgagtccgaggcgacctcgaagctgtcccgt
gagcacgccgtcgccaccccggtgcccgggctggtcgtcgtggccgggggcaagtacacg
acctatcgcgtgatggccgaggacgccgtcgacgcagccgtgcactcgctcgacgcgaag
gtgcccgcctcctgcaccgagaaggtcccgctgctcggcgccgagggcttcacggcgctg
cgcaactcgacccaccagctcgccgcgcgcagcgggctgcacccggtgcggatcgagcac
ctgctcggccggtacggctcgctgatcgacgaggtcctcgacctcctcatcgccgacccg
accctggccgagccgctcaccggcgccgaggactacctgcgggccgaggtcgtctacggc
gcctcgcacgagggcgcgcggcacctggaggacatcctcgcccgtcgcacccggatctcg
atcgagaccttcgaccggggcgtgggtgccgccgaggagaccgcgacgctggtcgccccg
gtgctgggctggaacgacgagcagatcgcccgcgaggtcgaccactacgtcaagcgggtc
gaggccgagcgggagagccagaagatgcccgacgacgccaccgccgacgccgcccgcctc
ggcgcgccggacgtggtgccggtcagcggctga

DBGET integrated database retrieval system