KEGG   Pseudonocardia sp. AL041005-10: WY02_24160Help
Entry
WY02_24160        CDS       T04051                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
psea  Pseudonocardia sp. AL041005-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DUF3509
Motif
Other DBs
NCBI-ProteinID: ALE80968
UniProt: A0A0M4QPJ3
LinkDB All DBs
Position
complement(5127324..5128388)
Genome map
AA seq 354 aa AA seqDB search
MDLPVMPPVKPMLAKPAPSIPEGRLYEPKWDGFRSIVFRDGDEVEIGSRNEKPMTRYFPE
VVEAVKAHFPPRAVVDGEIVVASGNALDFEALQQRIHPAASRVTLLSTETPASFVAFDLL
GLGDDDLTARPFAERRALLEEAFAGVAPPVHLTPVTDDTATARRWFEKFEGAGLDGLIAK
DPAGTYQPDKRVMTKVKHERTADCVVAGYRVHKSGPDAVGSLLLGLHDARGVLVSVGVVG
AFPMARRRELMTELQPLVSDFDDHPWAWAKQLEGERTPRKSETSRWNAGKDLSFVPLRPE
RVVEVRYDYMEGARFRHTTQFVRWRPDREPASCTYEQLERPVNFDLAEVLAGRG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcccgtgatgcccccggtgaagccgatgctggccaaacccgccccgtcgatc
cccgagggcaggctctacgagcccaagtgggacggcttccgctcgatcgtcttccgcgac
ggcgacgaggtggagatcggctcccgcaacgagaagccgatgacccgctacttccccgag
gtcgtcgaggcggtgaaggcgcacttccccccgcgcgcggtcgtcgacggggagatcgtc
gtcgcctccgggaacgcactggacttcgaggcgctccagcagcggatccaccccgcggcc
agccgggtgacgctgctctcgaccgagacgccggcgtcgttcgtggccttcgacctgcta
gggctcggcgacgacgacctcaccgcgcgcccgttcgccgagcgccgcgcgctgctggag
gaggcgttcgccggcgtcgccccgccggtgcacctcaccccggtcaccgacgacaccgcc
accgcgcgccgctggttcgagaagttcgagggcgccgggctcgacgggctcatcgcgaag
gacccggccgggacctaccagcccgacaagcgcgtcatgaccaaggtgaagcacgagcgg
accgcggactgcgtcgtcgccgggtaccgggtgcacaagtccggtccggacgccgtcggg
tcgctgctgctgggcctgcacgacgcccgcggggtgctggtgtcggtcggcgtcgtcggg
gcgttcccgatggcgcgccgccgcgagctcatgaccgagttgcagccgctggtcagcgac
ttcgacgaccacccgtgggcctgggcgaagcagctggagggcgagcgcacaccgcgcaag
tccgagacgagccggtggaacgccggcaaggacctgtccttcgtcccgctgcgcccggag
cgggtggtcgaggtccgctacgactacatggagggcgcgcggttccgccacaccacccag
ttcgtgcggtggcgcccggaccgcgagcctgcctcgtgcacctacgagcagctggagcgc
ccggtgaacttcgacctcgcggaggtgctcgccgggcgcgggtga

DBGET integrated database retrieval system