KEGG   Pseudorhodobacter sp. S12M18: EOK75_03780Help
Entry
EOK75_03780       CDS       T05954                                 

Definition
(GenBank) molybdopterin molybdotransferase MoeA
  KO
K03750  molybdopterin molybdotransferase [EC:2.10.1.1]
Organism
pseb  Pseudorhodobacter sp. S12M18
Pathway
pseb00790  Folate biosynthesis
pseb01100  Metabolic pathways
Module
pseb_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:pseb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EOK75_03780
Enzymes [BR:pseb01000]
 2. Transferases
  2.10  Transferring molybdenum- or tungsten-containing groups
   2.10.1  Molybdenumtransferases or tungstentransferases with sulfide groups as acceptors
    2.10.1.1  molybdopterin molybdotransferase
     EOK75_03780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoeA_N MoCF_biosynth MoeA_C
Motif
Other DBs
NCBI-ProteinID: QCO54985
UniProt: A0A4P8EEX5
LinkDB All DBs
Position
806992..808170
Genome map
AA seq 392 aa AA seqDB search
MISVDEALALSLGLVRPLEAETLPLAQAAGRYMVQPATARRDQPPFAASAMDGYAIRGPA
LPAAQFDVVGEASAGHAWAGTLTNGQALRIFTGAPVPAGADQVVIQENVTRDGDRITLGS
DLGTGRNIRPQGADFKAGDSLSARLLRATDLALLASMNVAAVCVTRRPVVAIIATGDELV
MPGETPRPDQIIASNSFALAAMAQHAGAITRMLPIARDTEASLHAVFALAQDADLIVTIG
GASVGDHDLVGKVAADLGMKRAFYKIAMRPGKPLMAGMLNGTPMLGLPGNPISSVVCGHL
FMMPMIRAMQGMPAPTPILQHARLTAPLDANGNRAHYMRAEVQHGPQGPEIRSLDNQDSA
LLTVLSAANALLLRPIGDGPRAIGEMVEYLAI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgatctcggttgatgaggcgctggccctgtcgctgggtctggtgcggccgctggaggct
gaaaccctgccattggcccaagcggcggggcgctacatggttcagcccgccaccgcgcgc
cgcgatcagccgccctttgccgcatccgcgatggacggctatgccattcgcggccccgcc
ctccccgctgcgcaatttgatgtggtgggggaggccagcgccggccatgcatgggcaggc
acgctgacgaacggccaagcgctgcgcatcttcactggcgcgccggttcctgcgggtgcc
gatcaagtggtgatccaggaaaatgtaacacgtgacggcgaccgcatcaccttgggttcc
gaccttggcaccggccgcaacatccgcccccaaggcgctgatttcaaagcgggtgacagc
ctgtctgcccgtctgctgcgcgccaccgatctggcgcttctggcctcaatgaatgtggcc
gcggtctgcgtgacgcgccgccccgtcgtcgccatcatcgccaccggagatgagctggtg
atgcccggagagacgccccgccccgatcagatcatcgcctccaacagctttgccttggcg
gcgatggcgcagcatgccggtgcgatcacccgcatgctgccaatcgcccgcgataccgag
gccagccttcacgctgtgttcgccctagcccaagacgccgatctgatcgtgaccattggc
ggtgcgtcagtcggagatcacgatctggttggcaaggtcgccgccgatctggggatgaag
cgcgcgttttacaaaatcgcgatgcgtccgggcaagccgcttatggccggaatgctcaac
ggcaccccaatgctcggccttccgggtaatccgatatcttcagtggtttgcgggcatttg
ttcatgatgcctatgatccgcgcgatgcaaggcatgcccgcacccacaccgattttgcaa
cacgccagattaactgcgcccttggacgccaacggcaaccgtgcccattatatgcgggca
gaggtgcagcacggcccgcaaggccctgagatccgcagcttggacaatcaggattccgcg
ctgttgacggtattatccgccgcgaacgcccttttgctgcgccccatcggggatggcccg
cgcgcgattggcgaaatggtcgaatacctcgcgatctaa

DBGET integrated database retrieval system