KEGG   Pseudorhodobacter sp. S12M18: EOK75_08760Help
Entry
EOK75_08760       CDS       T05954                                 

Definition
(GenBank) Hsp33 family molecular chaperone HslO
  KO
K04083  molecular chaperone Hsp33
Organism
pseb  Pseudorhodobacter sp. S12M18
Brite
KEGG Orthology (KO) [BR:pseb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pseb03110]
    EOK75_08760
Chaperones and folding catalysts [BR:pseb03110]
 Heat shock proteins
  HSP33
   EOK75_08760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: QCO55825
LinkDB All DBs
Position
1829432..1830418
Genome map
AA seq 328 aa AA seqDB search
MTIGTKIAWDDTVLPFQLDHSDVRGRVVRLDGTLDSVLKQHEYPAAVEALVAEATLLTAL
IGQMIKLRWKLSLQIRGNGPVSLIATDYYGPTEDGEPARLRAYASFDPEADLTDVDPFSL
IGEGFFAILIDQGEGMVPYQGITPIAGTSLSDCAETYFAQSEQLPTRFQLSFGKSTLPGE
ADQWRAGGMMLQMMPKASPYASDNGGSGDGGLLSHSDLVDGDEGENWNRVNLLLDTVEEL
ELIGPQVAPTDLLIRLFHEEQPRVFDTQPIRFGCTCSEDRVRQSLSIYGAEDIAEMTTED
GVLTADCQFCGAHYVLDPKTLGVEANEG
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcggaacaaaaattgcttgggacgacacagtcctaccatttcagcttgatcac
tctgacgtccggggccgcgttgtgcggctggatggcacgttggattctgtgctgaaacaa
catgaatatccggctgcggtagaggcgcttgtcgccgaagccacgcttttgaccgcattg
atcggtcaaatgataaaattgcgctggaagttgtcgctgcaaattcgcggcaatggcccg
gttagcttgatcgcaaccgattattacggcccgacagaagacggcgaacctgcccgtctg
cgcgcctatgccagtttcgatccagaggcggatttgaccgacgtggaccctttttccctg
atcggtgagggcttctttgccattctgattgatcaaggagagggcatggtgccatatcag
ggcatcacgccgatcgcgggcacctcgctttcggattgcgccgagacttattttgcccaa
tccgaacaattgccgacccgctttcagcttagcttcggcaaaagcacccttccgggagag
gcggatcaatggcgcgccggcggcatgatgttgcagatgatgcccaaggcatcgccttat
gcctccgataacggcggatcgggtgacggtggcctgctgtcgcatagcgatctggttgat
ggcgatgaaggtgaaaactggaatcgcgtgaacctgctgttggacacggtagaggagctg
gagctgatcggcccgcaagtcgcgccgaccgatttgctgatccgcctgttccacgaagaa
cagccccgcgtctttgacacccagcccatccggttcgggtgcacctgttccgaggatcgc
gtgcgtcagtcgctgtcgatctatggtgccgaggatatcgcggaaatgacaacggaggac
ggagttctgaccgccgattgccagttctgcggggcgcattatgtgctcgatccgaaaacg
cttggggttgaggccaatgaaggctga

DBGET integrated database retrieval system